Detailed information
Bioinformatically predicted
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | QNH17_RS28605 | Genome accession | NZ_CP126107 |
| Coordinates | 5829522..5829884 (-) | Length | 120 a.a. |
| NCBI ID | WP_283879624.1 | Uniprot ID | A0AA95MAI5 |
| Organism | Neobacillus sp. SuZ13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 5814021..5835187 | 5829522..5829884 | within | 0 |
Gene organization within MGE regions
Location: 5814021..5835187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH17_RS28535 (QNH17_28535) | - | 5814021..5815652 (+) | 1632 | WP_283876661.1 | SWIM zinc finger family protein | - |
| QNH17_RS28540 (QNH17_28540) | - | 5815773..5816066 (+) | 294 | WP_283876662.1 | RNA polymerase alpha subunit C-terminal domain-containing protein | - |
| QNH17_RS28545 (QNH17_28545) | - | 5816649..5819618 (+) | 2970 | WP_283876663.1 | DEAD/DEAH box helicase | - |
| QNH17_RS28550 (QNH17_28550) | - | 5819587..5819736 (+) | 150 | WP_283876664.1 | hypothetical protein | - |
| QNH17_RS28555 (QNH17_28555) | - | 5819977..5820120 (+) | 144 | WP_283876665.1 | hypothetical protein | - |
| QNH17_RS28560 (QNH17_28560) | - | 5820208..5821272 (-) | 1065 | WP_283876666.1 | hypothetical protein | - |
| QNH17_RS28565 (QNH17_28565) | - | 5821407..5822171 (-) | 765 | WP_283876667.1 | class I SAM-dependent methyltransferase | - |
| QNH17_RS28570 (QNH17_28570) | - | 5822603..5823433 (-) | 831 | WP_283876668.1 | aldo/keto reductase | - |
| QNH17_RS28575 (QNH17_28575) | - | 5823481..5824704 (-) | 1224 | WP_283876669.1 | MFS transporter | - |
| QNH17_RS28580 (QNH17_28580) | - | 5824901..5825272 (+) | 372 | WP_283876670.1 | winged helix-turn-helix transcriptional regulator | - |
| QNH17_RS28585 (QNH17_28585) | - | 5825408..5827093 (-) | 1686 | WP_283876671.1 | hypothetical protein | - |
| QNH17_RS28590 (QNH17_28590) | - | 5827234..5828373 (-) | 1140 | WP_283876672.1 | 3D domain-containing protein | - |
| QNH17_RS28595 (QNH17_28595) | - | 5828503..5828922 (-) | 420 | WP_283876673.1 | hypothetical protein | - |
| QNH17_RS28600 (QNH17_28600) | - | 5829291..5829515 (-) | 225 | WP_283876674.1 | hypothetical protein | - |
| QNH17_RS28605 (QNH17_28605) | ssbB | 5829522..5829884 (-) | 363 | WP_283879624.1 | single-stranded DNA-binding protein | Machinery gene |
| QNH17_RS28610 (QNH17_28610) | - | 5830130..5830564 (+) | 435 | WP_283876675.1 | YwpF family protein | - |
| QNH17_RS28615 (QNH17_28615) | - | 5830617..5831015 (-) | 399 | WP_283876676.1 | hypothetical protein | - |
| QNH17_RS28620 (QNH17_28620) | fabZ | 5831155..5831589 (-) | 435 | WP_098571481.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| QNH17_RS28625 (QNH17_28625) | - | 5831663..5832337 (-) | 675 | WP_283876677.1 | DNA-directed RNA polymerase subunit beta | - |
| QNH17_RS28630 (QNH17_28630) | - | 5832767..5833768 (-) | 1002 | WP_283876678.1 | rod shape-determining protein | - |
| QNH17_RS28635 (QNH17_28635) | spoIIID | 5833955..5834227 (-) | 273 | WP_026568271.1 | sporulation transcriptional regulator SpoIIID | - |
| QNH17_RS28640 (QNH17_28640) | - | 5834879..5835187 (+) | 309 | WP_283876679.1 | MGMT family protein | - |
Sequence
Protein
Download Length: 120 a.a. Molecular weight: 13576.36 Da Isoelectric Point: 8.2700
>NTDB_id=836315 QNH17_RS28605 WP_283879624.1 5829522..5829884(-) (ssbB) [Neobacillus sp. SuZ13]
MINQVTLVGRLTRDPELKQTTEGTAVAQVTLAVSRHFRNQNGEIEADFVQCTLWRKTAENTCQYCRKGAVIGITGRLQTR
NYDNKEGKRVYVTEVVAETVQFLSSKPQPHEVEAPPKKEE
MINQVTLVGRLTRDPELKQTTEGTAVAQVTLAVSRHFRNQNGEIEADFVQCTLWRKTAENTCQYCRKGAVIGITGRLQTR
NYDNKEGKRVYVTEVVAETVQFLSSKPQPHEVEAPPKKEE
Nucleotide
Download Length: 363 bp
>NTDB_id=836315 QNH17_RS28605 WP_283879624.1 5829522..5829884(-) (ssbB) [Neobacillus sp. SuZ13]
ATGATCAATCAAGTCACACTTGTTGGCAGGTTGACGCGGGACCCCGAATTAAAACAGACGACAGAAGGGACGGCCGTGGC
CCAAGTCACCCTGGCGGTGTCGCGTCACTTTCGCAACCAAAACGGCGAAATCGAAGCTGACTTTGTTCAATGCACACTTT
GGCGGAAAACAGCCGAAAATACGTGTCAATATTGCCGGAAAGGTGCAGTAATCGGAATCACGGGGCGATTGCAGACGCGG
AACTATGATAACAAAGAGGGGAAAAGGGTGTATGTCACAGAGGTAGTCGCGGAAACGGTACAGTTCCTAAGCTCCAAGCC
GCAGCCGCATGAAGTGGAAGCTCCTCCAAAAAAGGAGGAATGA
ATGATCAATCAAGTCACACTTGTTGGCAGGTTGACGCGGGACCCCGAATTAAAACAGACGACAGAAGGGACGGCCGTGGC
CCAAGTCACCCTGGCGGTGTCGCGTCACTTTCGCAACCAAAACGGCGAAATCGAAGCTGACTTTGTTCAATGCACACTTT
GGCGGAAAACAGCCGAAAATACGTGTCAATATTGCCGGAAAGGTGCAGTAATCGGAATCACGGGGCGATTGCAGACGCGG
AACTATGATAACAAAGAGGGGAAAAGGGTGTATGTCACAGAGGTAGTCGCGGAAACGGTACAGTTCCTAAGCTCCAAGCC
GCAGCCGCATGAAGTGGAAGCTCCTCCAAAAAAGGAGGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
64.815 |
90 |
0.583 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
88.333 |
0.533 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.717 |
88.333 |
0.483 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.296 |
90 |
0.417 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.296 |
90 |
0.417 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.37 |
90 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.37 |
90 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.37 |
90 |
0.408 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.37 |
90 |
0.408 |
| ssbA | Streptococcus mutans UA159 |
44.444 |
90 |
0.4 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.519 |
90 |
0.392 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.509 |
88.333 |
0.367 |