Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ49_RS09300 | Genome accession | NZ_CP124960 |
| Coordinates | 1869651..1869926 (-) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain EfsC1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1825413..1869627 | 1869651..1869926 | flank | 24 |
Gene organization within MGE regions
Location: 1825413..1869926
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ49_RS09000 (QLQ49_09000) | - | 1825413..1826417 (-) | 1005 | WP_048947018.1 | class I SAM-dependent methyltransferase | - |
| QLQ49_RS09005 (QLQ49_09005) | comGG | 1826546..1826899 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ49_RS09010 (QLQ49_09010) | comGF | 1826899..1827333 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ49_RS09015 (QLQ49_09015) | - | 1827323..1827649 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ49_RS09020 (QLQ49_09020) | hemH | 1828451..1829392 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ49_RS09030 (QLQ49_09030) | - | 1830108..1830380 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| QLQ49_RS09035 (QLQ49_09035) | - | 1830452..1830652 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ49_RS09040 (QLQ49_09040) | - | 1831517..1832758 (-) | 1242 | WP_002384372.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ49_RS09045 (QLQ49_09045) | - | 1832759..1832992 (-) | 234 | WP_002384371.1 | phage holin | - |
| QLQ49_RS09050 (QLQ49_09050) | - | 1832985..1833206 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| QLQ49_RS09055 (QLQ49_09055) | - | 1833241..1833396 (-) | 156 | WP_021732802.1 | XkdX family protein | - |
| QLQ49_RS09060 (QLQ49_09060) | - | 1833398..1833718 (-) | 321 | WP_010774127.1 | hypothetical protein | - |
| QLQ49_RS09065 (QLQ49_09065) | - | 1833732..1834223 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| QLQ49_RS09070 (QLQ49_09070) | - | 1834223..1834510 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| QLQ49_RS09075 (QLQ49_09075) | - | 1834507..1835103 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| QLQ49_RS09080 (QLQ49_09080) | - | 1835096..1835977 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| QLQ49_RS09085 (QLQ49_09085) | - | 1835996..1838803 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| QLQ49_RS09090 (QLQ49_09090) | - | 1838785..1839519 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| QLQ49_RS09095 (QLQ49_09095) | - | 1839509..1842406 (-) | 2898 | Protein_1769 | tape measure protein | - |
| QLQ49_RS09100 (QLQ49_09100) | - | 1842654..1843004 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| QLQ49_RS09105 (QLQ49_09105) | - | 1843057..1843905 (-) | 849 | WP_002384363.1 | major tail protein | - |
| QLQ49_RS09110 (QLQ49_09110) | - | 1843906..1844280 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| QLQ49_RS09115 (QLQ49_09115) | - | 1844283..1844627 (-) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| QLQ49_RS09120 (QLQ49_09120) | - | 1844981..1846231 (+) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ49_RS15105 | - | 1846369..1846452 (-) | 84 | Protein_1775 | HK97 gp10 family phage protein | - |
| QLQ49_RS09125 (QLQ49_09125) | - | 1846445..1846813 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| QLQ49_RS09130 (QLQ49_09130) | - | 1846810..1847154 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| QLQ49_RS09135 (QLQ49_09135) | - | 1847168..1847350 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| QLQ49_RS09140 (QLQ49_09140) | - | 1847379..1848266 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QLQ49_RS09145 (QLQ49_09145) | - | 1848280..1848903 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| QLQ49_RS09150 (QLQ49_09150) | - | 1849121..1849441 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| QLQ49_RS09155 (QLQ49_09155) | - | 1849506..1849727 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| QLQ49_RS09160 (QLQ49_09160) | - | 1849724..1851481 (-) | 1758 | WP_002384360.1 | head protein | - |
| QLQ49_RS09165 (QLQ49_09165) | - | 1851456..1852943 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| QLQ49_RS09170 (QLQ49_09170) | - | 1852955..1854244 (-) | 1290 | WP_174103405.1 | PBSX family phage terminase large subunit | - |
| QLQ49_RS09175 (QLQ49_09175) | terS | 1854216..1855019 (-) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| QLQ49_RS09180 (QLQ49_09180) | - | 1855066..1855788 (-) | 723 | WP_010815494.1 | DUF5677 domain-containing protein | - |
| QLQ49_RS09185 (QLQ49_09185) | - | 1856505..1857119 (-) | 615 | WP_002384355.1 | hypothetical protein | - |
| QLQ49_RS09195 (QLQ49_09195) | - | 1857650..1858066 (-) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ49_RS09200 (QLQ49_09200) | - | 1858973..1859396 (-) | 424 | Protein_1790 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ49_RS09205 (QLQ49_09205) | - | 1859414..1859713 (-) | 300 | WP_002364213.1 | MazG-like family protein | - |
| QLQ49_RS09210 (QLQ49_09210) | - | 1859714..1860016 (-) | 303 | WP_002364215.1 | hypothetical protein | - |
| QLQ49_RS09215 (QLQ49_09215) | - | 1860020..1860987 (-) | 968 | Protein_1793 | Lin1244/Lin1753 domain-containing protein | - |
| QLQ49_RS09220 (QLQ49_09220) | - | 1861001..1861891 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| QLQ49_RS09225 (QLQ49_09225) | - | 1861894..1862835 (-) | 942 | WP_002384348.1 | YqaJ viral recombinase family protein | - |
| QLQ49_RS09230 (QLQ49_09230) | - | 1862933..1863160 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| QLQ49_RS09235 (QLQ49_09235) | - | 1863160..1863483 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| QLQ49_RS09240 (QLQ49_09240) | - | 1863527..1863712 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| QLQ49_RS09245 (QLQ49_09245) | - | 1863703..1863897 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| QLQ49_RS09250 (QLQ49_09250) | - | 1863950..1864132 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| QLQ49_RS09255 (QLQ49_09255) | - | 1864172..1864894 (-) | 723 | WP_002364225.1 | phage regulatory protein | - |
| QLQ49_RS09260 (QLQ49_09260) | - | 1864933..1865250 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| QLQ49_RS09265 (QLQ49_09265) | - | 1865256..1865447 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| QLQ49_RS09270 (QLQ49_09270) | - | 1865738..1866082 (+) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| QLQ49_RS09275 (QLQ49_09275) | - | 1866087..1866734 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ49_RS09280 (QLQ49_09280) | - | 1866852..1867616 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| QLQ49_RS09285 (QLQ49_09285) | - | 1867631..1867960 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| QLQ49_RS09290 (QLQ49_09290) | - | 1868035..1869183 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| QLQ49_RS09295 (QLQ49_09295) | comGD | 1869211..1869654 (-) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ49_RS09300 (QLQ49_09300) | comGC/cglC | 1869651..1869926 (-) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=829805 QLQ49_RS09300 WP_002364235.1 1869651..1869926(-) (comGC/cglC) [Enterococcus faecalis strain EfsC1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829805 QLQ49_RS09300 WP_002364235.1 1869651..1869926(-) (comGC/cglC) [Enterococcus faecalis strain EfsC1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |