Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ64_RS05920 | Genome accession | NZ_CP124956 |
| Coordinates | 1172968..1173243 (+) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain EfsC13 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173267..1226734 | 1172968..1173243 | flank | 24 |
Gene organization within MGE regions
Location: 1172968..1226734
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ64_RS05920 (QLQ64_05920) | comGC/cglC | 1172968..1173243 (+) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ64_RS05925 (QLQ64_05925) | comGD | 1173240..1173683 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ64_RS05930 (QLQ64_05930) | - | 1173711..1174859 (-) | 1149 | WP_002389015.1 | site-specific integrase | - |
| QLQ64_RS05935 (QLQ64_05935) | - | 1174934..1175263 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| QLQ64_RS05940 (QLQ64_05940) | - | 1175278..1176042 (-) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| QLQ64_RS05945 (QLQ64_05945) | - | 1176160..1176807 (-) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ64_RS05950 (QLQ64_05950) | - | 1176812..1177156 (-) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| QLQ64_RS05955 (QLQ64_05955) | - | 1177447..1177638 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| QLQ64_RS05960 (QLQ64_05960) | - | 1177644..1177961 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| QLQ64_RS05965 (QLQ64_05965) | - | 1178000..1178722 (+) | 723 | WP_002364225.1 | phage regulatory protein | - |
| QLQ64_RS05970 (QLQ64_05970) | - | 1178762..1178944 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| QLQ64_RS05975 (QLQ64_05975) | - | 1178997..1179191 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| QLQ64_RS05980 (QLQ64_05980) | - | 1179182..1179367 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| QLQ64_RS05985 (QLQ64_05985) | - | 1179411..1179734 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| QLQ64_RS05990 (QLQ64_05990) | - | 1179734..1179961 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| QLQ64_RS05995 (QLQ64_05995) | - | 1180059..1181000 (+) | 942 | WP_002384348.1 | YqaJ viral recombinase family protein | - |
| QLQ64_RS06000 (QLQ64_06000) | - | 1181003..1181893 (+) | 891 | WP_002364218.1 | recombinase RecT | - |
| QLQ64_RS06005 (QLQ64_06005) | - | 1181907..1182874 (+) | 968 | Protein_1160 | Lin1244/Lin1753 domain-containing protein | - |
| QLQ64_RS06010 (QLQ64_06010) | - | 1182878..1183180 (+) | 303 | WP_002364215.1 | hypothetical protein | - |
| QLQ64_RS06015 (QLQ64_06015) | - | 1183181..1183480 (+) | 300 | WP_002364213.1 | MazG-like family protein | - |
| QLQ64_RS06020 (QLQ64_06020) | - | 1183498..1183921 (+) | 424 | Protein_1163 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ64_RS06025 (QLQ64_06025) | - | 1184828..1185244 (+) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ64_RS06035 (QLQ64_06035) | - | 1185775..1186389 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| QLQ64_RS06040 (QLQ64_06040) | - | 1187106..1187810 (+) | 705 | WP_002384357.1 | DUF5677 domain-containing protein | - |
| QLQ64_RS06045 (QLQ64_06045) | terS | 1187874..1188677 (+) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| QLQ64_RS06050 (QLQ64_06050) | - | 1188649..1189938 (+) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| QLQ64_RS06055 (QLQ64_06055) | - | 1189950..1191437 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| QLQ64_RS06060 (QLQ64_06060) | - | 1191412..1193169 (+) | 1758 | WP_002384360.1 | head protein | - |
| QLQ64_RS06065 (QLQ64_06065) | - | 1193166..1193387 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| QLQ64_RS06070 (QLQ64_06070) | - | 1193452..1193772 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| QLQ64_RS06075 (QLQ64_06075) | - | 1193990..1194613 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| QLQ64_RS06080 (QLQ64_06080) | - | 1194627..1195514 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QLQ64_RS06085 (QLQ64_06085) | - | 1195543..1195725 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| QLQ64_RS06090 (QLQ64_06090) | - | 1195739..1196083 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| QLQ64_RS06095 (QLQ64_06095) | - | 1196080..1196448 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| QLQ64_RS15335 | - | 1196441..1196524 (+) | 84 | Protein_1178 | HK97 gp10 family phage protein | - |
| QLQ64_RS06100 (QLQ64_06100) | - | 1196662..1197912 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ64_RS06105 (QLQ64_06105) | - | 1198266..1198610 (+) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| QLQ64_RS06110 (QLQ64_06110) | - | 1198613..1198987 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| QLQ64_RS06115 (QLQ64_06115) | - | 1198988..1199836 (+) | 849 | WP_002384363.1 | major tail protein | - |
| QLQ64_RS06120 (QLQ64_06120) | - | 1199889..1200239 (+) | 351 | WP_002357039.1 | hypothetical protein | - |
| QLQ64_RS06125 (QLQ64_06125) | - | 1200487..1203384 (+) | 2898 | Protein_1184 | tape measure protein | - |
| QLQ64_RS06130 (QLQ64_06130) | - | 1203374..1204108 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| QLQ64_RS06135 (QLQ64_06135) | - | 1204090..1206897 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| QLQ64_RS06140 (QLQ64_06140) | - | 1206916..1207797 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| QLQ64_RS06145 (QLQ64_06145) | - | 1207790..1208386 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| QLQ64_RS06150 (QLQ64_06150) | - | 1208383..1208670 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| QLQ64_RS06155 (QLQ64_06155) | - | 1208670..1209161 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| QLQ64_RS06160 (QLQ64_06160) | - | 1209175..1209495 (+) | 321 | WP_010774127.1 | hypothetical protein | - |
| QLQ64_RS06165 (QLQ64_06165) | - | 1209497..1209652 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| QLQ64_RS06170 (QLQ64_06170) | - | 1209687..1209908 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| QLQ64_RS06175 (QLQ64_06175) | - | 1209901..1210134 (+) | 234 | WP_002384371.1 | phage holin | - |
| QLQ64_RS06180 (QLQ64_06180) | - | 1210135..1211376 (+) | 1242 | WP_002384372.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ64_RS06185 (QLQ64_06185) | - | 1212241..1212441 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ64_RS06190 (QLQ64_06190) | - | 1212513..1212785 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| QLQ64_RS06200 (QLQ64_06200) | hemH | 1213501..1214442 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ64_RS06205 (QLQ64_06205) | - | 1215244..1215570 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ64_RS06210 (QLQ64_06210) | comGF | 1215560..1215994 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ64_RS06215 (QLQ64_06215) | comGG | 1215994..1216347 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ64_RS06220 (QLQ64_06220) | - | 1216476..1217483 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ64_RS06225 (QLQ64_06225) | - | 1217508..1218695 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| QLQ64_RS06230 (QLQ64_06230) | - | 1218807..1219280 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ64_RS06235 (QLQ64_06235) | - | 1219458..1219736 (-) | 279 | WP_002380425.1 | hypothetical protein | - |
| QLQ64_RS06245 (QLQ64_06245) | - | 1220064..1221341 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| QLQ64_RS06250 (QLQ64_06250) | - | 1221470..1222147 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| QLQ64_RS06255 (QLQ64_06255) | - | 1222104..1222589 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| QLQ64_RS06260 (QLQ64_06260) | prmA | 1222605..1223552 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| QLQ64_RS06265 (QLQ64_06265) | - | 1223554..1224306 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| QLQ64_RS06270 (QLQ64_06270) | - | 1224521..1226734 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=829758 QLQ64_RS05920 WP_002364235.1 1172968..1173243(+) (comGC/cglC) [Enterococcus faecalis strain EfsC13]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829758 QLQ64_RS05920 WP_002364235.1 1172968..1173243(+) (comGC/cglC) [Enterococcus faecalis strain EfsC13]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |