Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ51_RS08875 | Genome accession | NZ_CP124953 |
| Coordinates | 1794707..1794982 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsC23 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1753125..1794683 | 1794707..1794982 | flank | 24 |
Gene organization within MGE regions
Location: 1753125..1794982
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ51_RS08595 (QLQ51_08590) | - | 1753125..1754132 (-) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
| QLQ51_RS08600 (QLQ51_08595) | comGG | 1754261..1754614 (-) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ51_RS08605 (QLQ51_08600) | comGF | 1754614..1755048 (-) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ51_RS08610 (QLQ51_08605) | - | 1755038..1755364 (-) | 327 | WP_002390369.1 | type II secretion system protein | - |
| QLQ51_RS08615 (QLQ51_08610) | hemH | 1756166..1757107 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ51_RS08625 (QLQ51_08620) | - | 1757823..1758095 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ51_RS08630 (QLQ51_08625) | - | 1758167..1758367 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ51_RS08635 (QLQ51_08630) | - | 1759214..1760473 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ51_RS08640 (QLQ51_08635) | - | 1760870..1762120 (+) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ51_RS08645 (QLQ51_08640) | - | 1762257..1762637 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ51_RS08650 (QLQ51_08645) | - | 1762648..1762770 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ51_RS08655 (QLQ51_08650) | - | 1762772..1763167 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ51_RS08660 (QLQ51_08655) | - | 1763186..1763638 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ51_RS08665 (QLQ51_08660) | - | 1763655..1764395 (-) | 741 | WP_025193093.1 | hypothetical protein | - |
| QLQ51_RS08670 (QLQ51_08665) | - | 1764401..1765846 (-) | 1446 | WP_010712603.1 | phage tail spike protein | - |
| QLQ51_RS08675 (QLQ51_08670) | - | 1765846..1766568 (-) | 723 | WP_010785045.1 | hypothetical protein | - |
| QLQ51_RS08680 (QLQ51_08675) | - | 1766565..1771019 (-) | 4455 | WP_010785046.1 | phage tail tape measure protein | - |
| QLQ51_RS08685 (QLQ51_08680) | - | 1771006..1771311 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| QLQ51_RS08690 (QLQ51_08685) | - | 1771380..1771778 (-) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| QLQ51_RS08695 (QLQ51_08690) | - | 1771841..1772149 (-) | 309 | WP_010785047.1 | hypothetical protein | - |
| QLQ51_RS08700 (QLQ51_08695) | - | 1772152..1772757 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| QLQ51_RS08705 (QLQ51_08700) | - | 1772776..1773168 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| QLQ51_RS08710 (QLQ51_08705) | - | 1773165..1773503 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ51_RS08715 (QLQ51_08710) | - | 1773500..1773775 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| QLQ51_RS08720 (QLQ51_08715) | - | 1773772..1774104 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ51_RS08725 (QLQ51_08720) | - | 1774175..1775071 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| QLQ51_RS08730 (QLQ51_08725) | - | 1775085..1775720 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| QLQ51_RS08735 (QLQ51_08730) | - | 1775843..1776769 (-) | 927 | WP_010785048.1 | minor capsid protein | - |
| QLQ51_RS08740 (QLQ51_08735) | - | 1776762..1778246 (-) | 1485 | WP_010785049.1 | phage portal protein | - |
| QLQ51_RS08745 (QLQ51_08740) | - | 1778246..1779529 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| QLQ51_RS08750 (QLQ51_08745) | - | 1779510..1779944 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ51_RS08755 (QLQ51_08750) | - | 1779976..1780206 (-) | 231 | Protein_1698 | hypothetical protein | - |
| QLQ51_RS08760 (QLQ51_08755) | - | 1780677..1781039 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| QLQ51_RS08765 (QLQ51_08760) | - | 1781156..1782064 (-) | 909 | WP_002378460.1 | hypothetical protein | - |
| QLQ51_RS08775 (QLQ51_08770) | - | 1782779..1783195 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ51_RS08780 (QLQ51_08775) | - | 1784102..1784509 (-) | 408 | WP_024797260.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ51_RS08785 (QLQ51_08780) | - | 1784506..1785363 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| QLQ51_RS08790 (QLQ51_08785) | - | 1785363..1785563 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ51_RS08795 (QLQ51_08790) | - | 1785568..1786209 (-) | 642 | WP_002357009.1 | putative HNHc nuclease | - |
| QLQ51_RS08800 (QLQ51_08795) | - | 1786214..1786948 (-) | 735 | WP_002385820.1 | ERF family protein | - |
| QLQ51_RS08805 (QLQ51_08800) | - | 1786941..1787258 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ51_RS08810 (QLQ51_08805) | - | 1787478..1788032 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ51_RS08815 (QLQ51_08810) | - | 1788317..1788655 (-) | 339 | WP_002357003.1 | hypothetical protein | - |
| QLQ51_RS08820 (QLQ51_08815) | - | 1788692..1788901 (-) | 210 | WP_002357002.1 | hypothetical protein | - |
| QLQ51_RS08825 (QLQ51_08820) | - | 1788956..1789144 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ51_RS08830 (QLQ51_08825) | - | 1789170..1789892 (-) | 723 | WP_002357000.1 | phage regulatory protein | - |
| QLQ51_RS08835 (QLQ51_08830) | - | 1789915..1790226 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ51_RS14560 | - | 1790238..1790405 (-) | 168 | WP_002388204.1 | hypothetical protein | - |
| QLQ51_RS08840 (QLQ51_08835) | - | 1790823..1791020 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| QLQ51_RS08845 (QLQ51_08840) | - | 1791033..1791215 (-) | 183 | WP_002388205.1 | hypothetical protein | - |
| QLQ51_RS08850 (QLQ51_08845) | - | 1791507..1791842 (+) | 336 | WP_002388206.1 | helix-turn-helix domain-containing protein | - |
| QLQ51_RS08855 (QLQ51_08850) | - | 1791861..1792205 (+) | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ51_RS08860 (QLQ51_08855) | - | 1792263..1792991 (+) | 729 | WP_002388208.1 | ion transporter | - |
| QLQ51_RS08865 (QLQ51_08860) | - | 1793091..1794239 (+) | 1149 | WP_002388210.1 | site-specific integrase | - |
| QLQ51_RS08870 (QLQ51_08865) | comGD | 1794267..1794710 (-) | 444 | WP_016617790.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ51_RS08875 (QLQ51_08870) | comGC/cglC | 1794707..1794982 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=829729 QLQ51_RS08875 WP_002356991.1 1794707..1794982(-) (comGC/cglC) [Enterococcus faecalis strain EfsC23]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829729 QLQ51_RS08875 WP_002356991.1 1794707..1794982(-) (comGC/cglC) [Enterococcus faecalis strain EfsC23]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |