Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ43_RS09410 | Genome accession | NZ_CP124947 |
| Coordinates | 1873314..1873589 (-) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain EfsC43 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1833488..1891684 | 1873314..1873589 | within | 0 |
Gene organization within MGE regions
Location: 1833488..1891684
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ43_RS09135 (QLQ43_09130) | - | 1833488..1834495 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ43_RS09140 (QLQ43_09135) | comGG | 1834624..1834977 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ43_RS09145 (QLQ43_09140) | comGF | 1834977..1835411 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ43_RS09150 (QLQ43_09145) | - | 1835401..1835772 (-) | 372 | WP_172613785.1 | type II secretion system protein | - |
| QLQ43_RS09155 (QLQ43_09150) | hemH | 1836527..1837468 (-) | 942 | WP_302532220.1 | ferrochelatase | - |
| QLQ43_RS09165 (QLQ43_09160) | - | 1838185..1838457 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ43_RS09170 (QLQ43_09165) | - | 1838529..1838729 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ43_RS09175 (QLQ43_09170) | - | 1839582..1840841 (-) | 1260 | WP_010784601.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ43_RS09180 (QLQ43_09175) | - | 1840854..1841234 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ43_RS09185 (QLQ43_09180) | - | 1841245..1841367 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ43_RS09190 (QLQ43_09185) | - | 1841369..1841764 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ43_RS09195 (QLQ43_09190) | - | 1841783..1842235 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ43_RS09200 (QLQ43_09195) | - | 1842252..1842992 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| QLQ43_RS09205 (QLQ43_09200) | - | 1842998..1844443 (-) | 1446 | WP_010784602.1 | phage tail spike protein | - |
| QLQ43_RS09210 (QLQ43_09205) | - | 1844443..1845165 (-) | 723 | WP_010785045.1 | hypothetical protein | - |
| QLQ43_RS09215 (QLQ43_09210) | - | 1845162..1849616 (-) | 4455 | Protein_1786 | phage tail tape measure protein | - |
| QLQ43_RS09220 (QLQ43_09215) | - | 1849603..1849908 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| QLQ43_RS09225 (QLQ43_09220) | - | 1849977..1850375 (-) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| QLQ43_RS09230 (QLQ43_09225) | - | 1850438..1850746 (-) | 309 | WP_010785047.1 | hypothetical protein | - |
| QLQ43_RS09235 (QLQ43_09230) | - | 1850749..1851354 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| QLQ43_RS09240 (QLQ43_09235) | - | 1851373..1851765 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| QLQ43_RS09245 (QLQ43_09240) | - | 1851762..1852100 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ43_RS09250 (QLQ43_09245) | - | 1852097..1852372 (-) | 276 | WP_002364301.1 | hypothetical protein | - |
| QLQ43_RS09255 (QLQ43_09250) | - | 1852369..1852701 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ43_RS09260 (QLQ43_09255) | - | 1852772..1853668 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| QLQ43_RS09265 (QLQ43_09260) | - | 1853681..1854316 (-) | 636 | WP_254615300.1 | DUF4355 domain-containing protein | - |
| QLQ43_RS09270 (QLQ43_09265) | - | 1854439..1855365 (-) | 927 | WP_002363365.1 | minor capsid protein | - |
| QLQ43_RS09275 (QLQ43_09270) | - | 1855358..1856842 (-) | 1485 | WP_010784607.1 | phage portal protein | - |
| QLQ43_RS09280 (QLQ43_09275) | - | 1856842..1858125 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| QLQ43_RS09285 (QLQ43_09280) | - | 1858106..1858540 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ43_RS09290 (QLQ43_09285) | - | 1858572..1858802 (-) | 231 | WP_010784608.1 | hypothetical protein | - |
| QLQ43_RS09295 (QLQ43_09290) | - | 1859235..1859702 (-) | 468 | WP_010784780.1 | hypothetical protein | - |
| QLQ43_RS09300 (QLQ43_09295) | - | 1859728..1860678 (-) | 951 | WP_010784610.1 | hypothetical protein | - |
| QLQ43_RS09310 (QLQ43_09305) | - | 1861388..1861804 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ43_RS09315 (QLQ43_09310) | - | 1862711..1863118 (-) | 408 | WP_024797260.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ43_RS09320 (QLQ43_09315) | - | 1863115..1863972 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| QLQ43_RS09325 (QLQ43_09320) | - | 1863972..1864172 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ43_RS09330 (QLQ43_09325) | - | 1864177..1864818 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| QLQ43_RS09335 (QLQ43_09330) | - | 1864823..1865557 (-) | 735 | WP_002364345.1 | ERF family protein | - |
| QLQ43_RS09340 (QLQ43_09335) | - | 1865550..1865867 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ43_RS09345 (QLQ43_09340) | - | 1866087..1866641 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ43_RS09350 (QLQ43_09345) | - | 1866926..1867264 (-) | 339 | WP_033783419.1 | hypothetical protein | - |
| QLQ43_RS09355 (QLQ43_09350) | - | 1867301..1867510 (-) | 210 | WP_002399426.1 | hypothetical protein | - |
| QLQ43_RS09360 (QLQ43_09355) | - | 1867565..1867753 (+) | 189 | WP_002364350.1 | YegP family protein | - |
| QLQ43_RS09365 (QLQ43_09360) | - | 1867779..1868504 (-) | 726 | WP_002364352.1 | phage regulatory protein | - |
| QLQ43_RS09370 (QLQ43_09365) | - | 1868543..1868854 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ43_RS14750 | - | 1868866..1869033 (-) | 168 | WP_033624736.1 | hypothetical protein | - |
| QLQ43_RS09375 (QLQ43_09370) | - | 1869451..1869648 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| QLQ43_RS09380 (QLQ43_09375) | - | 1869661..1869843 (-) | 183 | WP_002358110.1 | hypothetical protein | - |
| QLQ43_RS09385 (QLQ43_09380) | - | 1870141..1870473 (+) | 333 | WP_002392358.1 | helix-turn-helix domain-containing protein | - |
| QLQ43_RS09390 (QLQ43_09385) | - | 1870491..1870835 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ43_RS09395 (QLQ43_09390) | - | 1870870..1871598 (+) | 729 | WP_010784612.1 | ion transporter | - |
| QLQ43_RS09400 (QLQ43_09395) | - | 1871698..1872846 (+) | 1149 | WP_002388210.1 | site-specific integrase | - |
| QLQ43_RS09405 (QLQ43_09400) | comGD | 1872874..1873317 (-) | 444 | WP_002388212.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ43_RS09410 (QLQ43_09405) | comGC/cglC | 1873314..1873589 (-) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ43_RS09415 (QLQ43_09410) | comGB | 1873589..1874635 (-) | 1047 | WP_002403888.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ43_RS09420 (QLQ43_09415) | comGA | 1874592..1875560 (-) | 969 | WP_002364237.1 | competence type IV pilus ATPase ComGA | - |
| QLQ43_RS09425 (QLQ43_09420) | - | 1875801..1877129 (-) | 1329 | WP_010784613.1 | APC family permease | - |
| QLQ43_RS09430 (QLQ43_09425) | rlmN | 1877419..1878492 (-) | 1074 | WP_002364241.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QLQ43_RS09435 (QLQ43_09430) | - | 1878616..1880445 (-) | 1830 | WP_002403891.1 | ABC transporter permease | - |
| QLQ43_RS09440 (QLQ43_09435) | - | 1880435..1881184 (-) | 750 | WP_002384339.1 | ABC transporter ATP-binding protein | - |
| QLQ43_RS09445 (QLQ43_09440) | - | 1881302..1882003 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| QLQ43_RS09450 (QLQ43_09445) | - | 1882124..1884547 (-) | 2424 | WP_002362065.1 | DNA translocase FtsK | - |
| QLQ43_RS09455 (QLQ43_09450) | - | 1884861..1886072 (-) | 1212 | WP_002364245.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QLQ43_RS09460 (QLQ43_09455) | - | 1886101..1887006 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| QLQ43_RS09465 (QLQ43_09460) | - | 1887128..1888108 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| QLQ43_RS09470 (QLQ43_09465) | cydC | 1888188..1889954 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| QLQ43_RS09475 (QLQ43_09470) | cydD | 1889951..1891684 (-) | 1734 | WP_002364247.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=829654 QLQ43_RS09410 WP_002364235.1 1873314..1873589(-) (comGC/cglC) [Enterococcus faecalis strain EfsC43]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829654 QLQ43_RS09410 WP_002364235.1 1873314..1873589(-) (comGC/cglC) [Enterococcus faecalis strain EfsC43]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |