Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ36_RS06145 | Genome accession | NZ_CP124928 |
| Coordinates | 1306306..1306581 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsPF27 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1306605..1348163 | 1306306..1306581 | flank | 24 |
Gene organization within MGE regions
Location: 1306306..1348163
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ36_RS06145 (QLQ36_06145) | comGC/cglC | 1306306..1306581 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ36_RS06150 (QLQ36_06150) | comGD | 1306578..1307021 (+) | 444 | WP_016617790.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ36_RS06155 (QLQ36_06155) | - | 1307049..1308197 (-) | 1149 | WP_002388210.1 | site-specific integrase | - |
| QLQ36_RS06160 (QLQ36_06160) | - | 1308297..1309025 (-) | 729 | WP_002388208.1 | ion transporter | - |
| QLQ36_RS06165 (QLQ36_06165) | - | 1309083..1309427 (-) | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ36_RS06170 (QLQ36_06170) | - | 1309446..1309781 (-) | 336 | WP_002388206.1 | helix-turn-helix domain-containing protein | - |
| QLQ36_RS06175 (QLQ36_06175) | - | 1310073..1310255 (+) | 183 | WP_002388205.1 | hypothetical protein | - |
| QLQ36_RS06180 (QLQ36_06180) | - | 1310268..1310465 (+) | 198 | WP_010712611.1 | hypothetical protein | - |
| QLQ36_RS14555 | - | 1310883..1311050 (+) | 168 | WP_002388204.1 | hypothetical protein | - |
| QLQ36_RS06185 (QLQ36_06185) | - | 1311062..1311373 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ36_RS06190 (QLQ36_06190) | - | 1311396..1312118 (+) | 723 | WP_002357000.1 | phage regulatory protein | - |
| QLQ36_RS06195 (QLQ36_06195) | - | 1312144..1312332 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ36_RS06200 (QLQ36_06200) | - | 1312387..1312596 (+) | 210 | WP_002357002.1 | hypothetical protein | - |
| QLQ36_RS06205 (QLQ36_06205) | - | 1312633..1312971 (+) | 339 | WP_002357003.1 | hypothetical protein | - |
| QLQ36_RS06210 (QLQ36_06210) | - | 1313256..1313810 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ36_RS06215 (QLQ36_06215) | - | 1314030..1314347 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ36_RS06220 (QLQ36_06220) | - | 1314340..1315074 (+) | 735 | WP_002385820.1 | ERF family protein | - |
| QLQ36_RS06225 (QLQ36_06225) | - | 1315079..1315720 (+) | 642 | WP_002357009.1 | putative HNHc nuclease | - |
| QLQ36_RS06230 (QLQ36_06230) | - | 1315725..1315925 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ36_RS06235 (QLQ36_06235) | - | 1315925..1316782 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| QLQ36_RS06240 (QLQ36_06240) | - | 1316779..1317186 (+) | 408 | WP_024797260.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ36_RS06245 (QLQ36_06245) | - | 1318093..1318509 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ36_RS06255 (QLQ36_06255) | - | 1319224..1320132 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| QLQ36_RS06260 (QLQ36_06260) | - | 1320249..1320611 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| QLQ36_RS06265 (QLQ36_06265) | - | 1321082..1321312 (+) | 231 | Protein_1233 | hypothetical protein | - |
| QLQ36_RS06270 (QLQ36_06270) | - | 1321344..1321778 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ36_RS06275 (QLQ36_06275) | - | 1321759..1323042 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| QLQ36_RS06280 (QLQ36_06280) | - | 1323042..1324526 (+) | 1485 | WP_010785049.1 | phage portal protein | - |
| QLQ36_RS06285 (QLQ36_06285) | - | 1324519..1325445 (+) | 927 | WP_010785048.1 | minor capsid protein | - |
| QLQ36_RS06290 (QLQ36_06290) | - | 1325568..1326203 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| QLQ36_RS06295 (QLQ36_06295) | - | 1326217..1327113 (+) | 897 | WP_002363368.1 | hypothetical protein | - |
| QLQ36_RS06300 (QLQ36_06300) | - | 1327184..1327516 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ36_RS06305 (QLQ36_06305) | - | 1327513..1327788 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| QLQ36_RS06310 (QLQ36_06310) | - | 1327785..1328123 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ36_RS06315 (QLQ36_06315) | - | 1328120..1328512 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| QLQ36_RS06320 (QLQ36_06320) | - | 1328531..1329136 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| QLQ36_RS06325 (QLQ36_06325) | - | 1329139..1329447 (+) | 309 | WP_010785047.1 | hypothetical protein | - |
| QLQ36_RS06330 (QLQ36_06330) | - | 1329510..1329908 (+) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| QLQ36_RS06335 (QLQ36_06335) | - | 1329977..1330282 (+) | 306 | WP_002364305.1 | hypothetical protein | - |
| QLQ36_RS06340 (QLQ36_06340) | - | 1330269..1334723 (+) | 4455 | WP_010785046.1 | phage tail tape measure protein | - |
| QLQ36_RS06345 (QLQ36_06345) | - | 1334720..1335442 (+) | 723 | WP_010785045.1 | hypothetical protein | - |
| QLQ36_RS06350 (QLQ36_06350) | - | 1335442..1336887 (+) | 1446 | WP_010712603.1 | phage tail spike protein | - |
| QLQ36_RS06355 (QLQ36_06355) | - | 1336893..1337633 (+) | 741 | WP_025193093.1 | hypothetical protein | - |
| QLQ36_RS06360 (QLQ36_06360) | - | 1337650..1338102 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ36_RS06365 (QLQ36_06365) | - | 1338121..1338516 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ36_RS06370 (QLQ36_06370) | - | 1338518..1338640 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ36_RS06375 (QLQ36_06375) | - | 1338651..1339031 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ36_RS06380 (QLQ36_06380) | - | 1339168..1340418 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ36_RS06385 (QLQ36_06385) | - | 1340815..1342074 (+) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ36_RS06390 (QLQ36_06390) | - | 1342921..1343121 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ36_RS06395 (QLQ36_06395) | - | 1343193..1343465 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ36_RS06405 (QLQ36_06405) | hemH | 1344181..1345122 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ36_RS06410 (QLQ36_06410) | - | 1345420..1345545 (-) | 126 | WP_002357058.1 | hypothetical protein | - |
| QLQ36_RS06415 (QLQ36_06415) | - | 1345924..1346250 (+) | 327 | WP_002390369.1 | type II secretion system protein | - |
| QLQ36_RS06420 (QLQ36_06420) | comGF | 1346240..1346674 (+) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ36_RS06425 (QLQ36_06425) | comGG | 1346674..1347027 (+) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ36_RS06430 (QLQ36_06430) | - | 1347156..1348163 (+) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=829500 QLQ36_RS06145 WP_002356991.1 1306306..1306581(+) (comGC/cglC) [Enterococcus faecalis strain EfsPF27]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829500 QLQ36_RS06145 WP_002356991.1 1306306..1306581(+) (comGC/cglC) [Enterococcus faecalis strain EfsPF27]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |