Detailed information NTG0829500

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: QLQ36_RS06145
• Genome accession: NZ_CP124928
• Coordinates: 1306306..1306581 (+)
• Length: 91 a.a.
• NCBI ID: WP_002356991.1
• Uniprot ID: A0A1B4XPV0
• Organism: Enterococcus faecalis strain EfsPF27
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1301306..1311581

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QLQ36_RS06125 (QLQ36_06125)	rlmN	1301402..1302475 (+)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-
QLQ36_RS06130 (QLQ36_06130)	-	1302765..1304093 (+)	1329	WP_002360022.1	APC family permease	-
QLQ36_RS06135 (QLQ36_06135)	comGA	1304335..1305303 (+)	969	WP_002369168.1	competence type IV pilus ATPase ComGA	-
QLQ36_RS06140 (QLQ36_06140)	comGB	1305260..1306306 (+)	1047	WP_002369171.1	competence type IV pilus assembly protein ComGB	-
QLQ36_RS06145 (QLQ36_06145)	comGC/cglC	1306306..1306581 (+)	276	WP_002356991.1	competence type IV pilus major pilin ComGC	Machinery gene
QLQ36_RS06150 (QLQ36_06150)	comGD	1306578..1307021 (+)	444	WP_016617790.1	competence type IV pilus minor pilin ComGD	-
QLQ36_RS06155 (QLQ36_06155)	-	1307049..1308197 (-)	1149	WP_002388210.1	site-specific integrase	-
QLQ36_RS06160 (QLQ36_06160)	-	1308297..1309025 (-)	729	WP_002388208.1	ion transporter	-
QLQ36_RS06165 (QLQ36_06165)	-	1309083..1309427 (-)	345	WP_002388207.1	ImmA/IrrE family metallo-endopeptidase	-
QLQ36_RS06170 (QLQ36_06170)	-	1309446..1309781 (-)	336	WP_002388206.1	helix-turn-helix domain-containing protein	-
QLQ36_RS06175 (QLQ36_06175)	-	1310073..1310255 (+)	183	WP_002388205.1	hypothetical protein	-
QLQ36_RS06180 (QLQ36_06180)	-	1310268..1310465 (+)	198	WP_010712611.1	hypothetical protein	-
QLQ36_RS14555	-	1310883..1311050 (+)	168	WP_002388204.1	hypothetical protein	-
QLQ36_RS06185 (QLQ36_06185)	-	1311062..1311373 (+)	312	WP_002381719.1	hypothetical protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.41 Da
• Isoelectric Point: 9.3192

>NTDB_id=829500 QLQ36_RS06145 WP_002356991.1 1306306..1306581(+) (comGC/cglC) [Enterococcus faecalis strain EfsPF27]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=829500 QLQ36_RS06145 WP_002356991.1 1306306..1306581(+) (comGC/cglC) [Enterococcus faecalis strain EfsPF27]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	46.835	86.813	0.407
comGC	Staphylococcus aureus N315	46.835	86.813	0.407
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396