Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ57_RS09335 | Genome accession | NZ_CP124925 |
| Coordinates | 1876711..1876986 (-) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain EfsPF36 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1832474..1895091 | 1876711..1876986 | within | 0 |
Gene organization within MGE regions
Location: 1832474..1895091
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ57_RS09035 (QLQ57_09035) | - | 1832474..1833481 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ57_RS09040 (QLQ57_09040) | comGG | 1833610..1833963 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ57_RS09045 (QLQ57_09045) | comGF | 1833963..1834397 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ57_RS09050 (QLQ57_09050) | - | 1834387..1834713 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ57_RS09055 (QLQ57_09055) | hemH | 1835515..1836456 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ57_RS09065 (QLQ57_09065) | - | 1837172..1837444 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| QLQ57_RS09070 (QLQ57_09070) | - | 1837516..1837716 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ57_RS09075 (QLQ57_09075) | - | 1838575..1839816 (-) | 1242 | WP_002384372.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ57_RS09080 (QLQ57_09080) | - | 1839817..1840050 (-) | 234 | WP_002384371.1 | phage holin | - |
| QLQ57_RS09085 (QLQ57_09085) | - | 1840043..1840264 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| QLQ57_RS09090 (QLQ57_09090) | - | 1840299..1840454 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| QLQ57_RS09095 (QLQ57_09095) | - | 1840456..1840776 (-) | 321 | WP_010774127.1 | hypothetical protein | - |
| QLQ57_RS09100 (QLQ57_09100) | - | 1840790..1841281 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| QLQ57_RS09105 (QLQ57_09105) | - | 1841281..1841568 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| QLQ57_RS09110 (QLQ57_09110) | - | 1841565..1842161 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| QLQ57_RS09115 (QLQ57_09115) | - | 1842154..1843035 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| QLQ57_RS09120 (QLQ57_09120) | - | 1843054..1845861 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| QLQ57_RS09125 (QLQ57_09125) | - | 1845843..1846577 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| QLQ57_RS09130 (QLQ57_09130) | - | 1846567..1849464 (-) | 2898 | Protein_1775 | tape measure protein | - |
| QLQ57_RS09135 (QLQ57_09135) | - | 1849712..1850062 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| QLQ57_RS09140 (QLQ57_09140) | - | 1850115..1850963 (-) | 849 | WP_002384363.1 | major tail protein | - |
| QLQ57_RS09145 (QLQ57_09145) | - | 1850964..1851338 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| QLQ57_RS09150 (QLQ57_09150) | - | 1851341..1851685 (-) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| QLQ57_RS09155 (QLQ57_09155) | - | 1852039..1853289 (+) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ57_RS15465 | - | 1853427..1853510 (-) | 84 | Protein_1781 | HK97 gp10 family phage protein | - |
| QLQ57_RS09160 (QLQ57_09160) | - | 1853503..1853871 (-) | 369 | WP_142428003.1 | hypothetical protein | - |
| QLQ57_RS09165 (QLQ57_09165) | - | 1853868..1854212 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| QLQ57_RS09170 (QLQ57_09170) | - | 1854226..1854408 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| QLQ57_RS09175 (QLQ57_09175) | - | 1854437..1855324 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QLQ57_RS09180 (QLQ57_09180) | - | 1855338..1855961 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| QLQ57_RS09185 (QLQ57_09185) | - | 1856179..1856499 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| QLQ57_RS09190 (QLQ57_09190) | - | 1856564..1856785 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| QLQ57_RS09195 (QLQ57_09195) | - | 1856782..1858539 (-) | 1758 | WP_002384360.1 | head protein | - |
| QLQ57_RS09200 (QLQ57_09200) | - | 1858514..1860001 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| QLQ57_RS09205 (QLQ57_09205) | - | 1860013..1861302 (-) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| QLQ57_RS09210 (QLQ57_09210) | terS | 1861274..1862077 (-) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| QLQ57_RS09215 (QLQ57_09215) | - | 1862124..1862846 (-) | 723 | WP_010815494.1 | DUF5677 domain-containing protein | - |
| QLQ57_RS09220 (QLQ57_09220) | - | 1863563..1864177 (-) | 615 | WP_002384355.1 | hypothetical protein | - |
| QLQ57_RS09230 (QLQ57_09230) | - | 1864708..1865124 (-) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ57_RS09235 (QLQ57_09235) | - | 1866031..1866454 (-) | 424 | Protein_1796 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ57_RS09240 (QLQ57_09240) | - | 1866472..1866771 (-) | 300 | WP_002357015.1 | MazG-like family protein | - |
| QLQ57_RS09245 (QLQ57_09245) | - | 1866772..1867074 (-) | 303 | WP_002364215.1 | hypothetical protein | - |
| QLQ57_RS09250 (QLQ57_09250) | - | 1867078..1868040 (-) | 963 | WP_002364216.1 | Lin1244/Lin1753 domain-containing protein | - |
| QLQ57_RS09255 (QLQ57_09255) | - | 1868054..1868944 (-) | 891 | WP_010708318.1 | recombinase RecT | - |
| QLQ57_RS09260 (QLQ57_09260) | - | 1868947..1869888 (-) | 942 | WP_002384348.1 | YqaJ viral recombinase family protein | - |
| QLQ57_RS09265 (QLQ57_09265) | - | 1869986..1870213 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| QLQ57_RS09270 (QLQ57_09270) | - | 1870213..1870536 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| QLQ57_RS09275 (QLQ57_09275) | - | 1870580..1870772 (-) | 193 | Protein_1804 | hypothetical protein | - |
| QLQ57_RS09280 (QLQ57_09280) | - | 1870763..1870957 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| QLQ57_RS09285 (QLQ57_09285) | - | 1871010..1871192 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| QLQ57_RS09290 (QLQ57_09290) | - | 1871232..1871954 (-) | 723 | WP_002364225.1 | phage regulatory protein | - |
| QLQ57_RS09295 (QLQ57_09295) | - | 1871993..1872310 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| QLQ57_RS09300 (QLQ57_09300) | - | 1872316..1872507 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| QLQ57_RS09305 (QLQ57_09305) | - | 1872798..1873142 (+) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| QLQ57_RS09310 (QLQ57_09310) | - | 1873147..1873794 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ57_RS09315 (QLQ57_09315) | - | 1873912..1874676 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| QLQ57_RS09320 (QLQ57_09320) | - | 1874691..1875020 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| QLQ57_RS09325 (QLQ57_09325) | - | 1875095..1876243 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| QLQ57_RS09330 (QLQ57_09330) | comGD | 1876271..1876714 (-) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ57_RS09335 (QLQ57_09335) | comGC/cglC | 1876711..1876986 (-) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ57_RS09340 (QLQ57_09340) | comGB | 1876986..1878032 (-) | 1047 | WP_002384344.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ57_RS09345 (QLQ57_09345) | comGA | 1877989..1878957 (-) | 969 | WP_002364237.1 | competence type IV pilus ATPase ComGA | - |
| QLQ57_RS09350 (QLQ57_09350) | - | 1879198..1880526 (-) | 1329 | WP_002384343.1 | APC family permease | - |
| QLQ57_RS09355 (QLQ57_09355) | rlmN | 1880816..1881889 (-) | 1074 | WP_002384342.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QLQ57_RS09360 (QLQ57_09360) | - | 1882013..1883842 (-) | 1830 | WP_002384340.1 | ABC transporter permease | - |
| QLQ57_RS09365 (QLQ57_09365) | - | 1883832..1884581 (-) | 750 | WP_002384339.1 | ABC transporter ATP-binding protein | - |
| QLQ57_RS09370 (QLQ57_09370) | - | 1884699..1885400 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| QLQ57_RS09375 (QLQ57_09375) | - | 1885531..1887954 (-) | 2424 | WP_002384338.1 | DNA translocase FtsK | - |
| QLQ57_RS09380 (QLQ57_09380) | - | 1888268..1889479 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QLQ57_RS09385 (QLQ57_09385) | - | 1889508..1890413 (-) | 906 | WP_002384337.1 | prenyltransferase | - |
| QLQ57_RS09390 (QLQ57_09390) | - | 1890535..1891515 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| QLQ57_RS09395 (QLQ57_09395) | cydC | 1891595..1893361 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| QLQ57_RS09400 (QLQ57_09400) | cydD | 1893358..1895091 (-) | 1734 | WP_002384336.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=829466 QLQ57_RS09335 WP_002364235.1 1876711..1876986(-) (comGC/cglC) [Enterococcus faecalis strain EfsPF36]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829466 QLQ57_RS09335 WP_002364235.1 1876711..1876986(-) (comGC/cglC) [Enterococcus faecalis strain EfsPF36]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |