Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ56_RS08750 | Genome accession | NZ_CP124921 |
| Coordinates | 1804378..1804653 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsC12 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1755215..1804354 | 1804378..1804653 | flank | 24 |
Gene organization within MGE regions
Location: 1755215..1804653
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ56_RS08420 (QLQ56_08420) | - | 1755215..1757428 (-) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| QLQ56_RS08425 (QLQ56_08425) | - | 1757643..1758395 (-) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| QLQ56_RS08430 (QLQ56_08430) | prmA | 1758397..1759344 (-) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| QLQ56_RS08435 (QLQ56_08435) | - | 1759360..1759845 (-) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| QLQ56_RS08440 (QLQ56_08440) | - | 1759802..1760479 (-) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| QLQ56_RS08445 (QLQ56_08445) | - | 1760608..1761885 (+) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| QLQ56_RS08455 (QLQ56_08455) | - | 1762213..1762491 (+) | 279 | WP_002380425.1 | hypothetical protein | - |
| QLQ56_RS14135 | - | 1762498..1762569 (+) | 72 | Protein_1645 | Rrf2 family transcriptional regulator | - |
| QLQ56_RS08460 (QLQ56_08460) | - | 1762807..1763280 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ56_RS08465 (QLQ56_08465) | - | 1763392..1764579 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ56_RS08470 (QLQ56_08470) | - | 1764604..1765611 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ56_RS08475 (QLQ56_08475) | comGG | 1765740..1766093 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ56_RS08480 (QLQ56_08480) | comGF | 1766093..1766527 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ56_RS08485 (QLQ56_08485) | - | 1766517..1766888 (-) | 372 | WP_170310356.1 | type II secretion system protein | - |
| QLQ56_RS08490 (QLQ56_08490) | hemH | 1767643..1768584 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ56_RS08500 (QLQ56_08500) | - | 1769300..1769572 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ56_RS08505 (QLQ56_08505) | - | 1769644..1769844 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ56_RS08510 (QLQ56_08510) | - | 1770697..1771956 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ56_RS08515 (QLQ56_08515) | - | 1771969..1772349 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ56_RS08520 (QLQ56_08520) | - | 1772360..1772482 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ56_RS08525 (QLQ56_08525) | - | 1772484..1772879 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ56_RS08530 (QLQ56_08530) | - | 1772898..1773350 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ56_RS08535 (QLQ56_08535) | - | 1773367..1774107 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| QLQ56_RS08540 (QLQ56_08540) | - | 1774113..1775558 (-) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| QLQ56_RS08545 (QLQ56_08545) | - | 1775558..1776280 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| QLQ56_RS08550 (QLQ56_08550) | - | 1776277..1780731 (-) | 4455 | WP_047649133.1 | phage tail tape measure protein | - |
| QLQ56_RS08555 (QLQ56_08555) | - | 1780718..1781023 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| QLQ56_RS08560 (QLQ56_08560) | - | 1781092..1781490 (-) | 399 | WP_002363376.1 | tail assembly chaperone | - |
| QLQ56_RS08565 (QLQ56_08565) | - | 1781553..1781861 (-) | 309 | WP_002381737.1 | hypothetical protein | - |
| QLQ56_RS08570 (QLQ56_08570) | - | 1781864..1782469 (-) | 606 | WP_002381736.1 | phage major tail protein, TP901-1 family | - |
| QLQ56_RS08575 (QLQ56_08575) | - | 1782489..1782881 (-) | 393 | WP_002381735.1 | hypothetical protein | - |
| QLQ56_RS08580 (QLQ56_08580) | - | 1782878..1783216 (-) | 339 | WP_002381734.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ56_RS08585 (QLQ56_08585) | - | 1783213..1783488 (-) | 276 | WP_002364301.1 | hypothetical protein | - |
| QLQ56_RS08590 (QLQ56_08590) | - | 1783485..1783817 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ56_RS08595 (QLQ56_08595) | - | 1783888..1784784 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| QLQ56_RS08600 (QLQ56_08600) | - | 1784797..1785432 (-) | 636 | WP_010717040.1 | DUF4355 domain-containing protein | - |
| QLQ56_RS08605 (QLQ56_08605) | - | 1785555..1786481 (-) | 927 | WP_002363365.1 | minor capsid protein | - |
| QLQ56_RS08610 (QLQ56_08610) | - | 1786474..1787958 (-) | 1485 | WP_002381731.1 | phage portal protein | - |
| QLQ56_RS08615 (QLQ56_08615) | - | 1787958..1789241 (-) | 1284 | WP_002381730.1 | PBSX family phage terminase large subunit | - |
| QLQ56_RS08620 (QLQ56_08620) | - | 1789222..1789656 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ56_RS08625 (QLQ56_08625) | - | 1789688..1789918 (-) | 231 | WP_002400650.1 | hypothetical protein | - |
| QLQ56_RS08630 (QLQ56_08630) | - | 1790290..1790883 (-) | 594 | WP_010717041.1 | hypothetical protein | - |
| QLQ56_RS08635 (QLQ56_08635) | - | 1790905..1791879 (-) | 975 | WP_010717042.1 | DUF6731 family protein | - |
| QLQ56_RS08645 (QLQ56_08645) | - | 1792596..1793012 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ56_RS08650 (QLQ56_08650) | - | 1793920..1794354 (-) | 435 | WP_025192316.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ56_RS08655 (QLQ56_08655) | - | 1794363..1794662 (-) | 300 | WP_002357015.1 | MazG-like family protein | - |
| QLQ56_RS08660 (QLQ56_08660) | - | 1794663..1794965 (-) | 303 | WP_002357013.1 | hypothetical protein | - |
| QLQ56_RS08665 (QLQ56_08665) | - | 1794969..1795826 (-) | 858 | WP_002357012.1 | helix-turn-helix domain-containing protein | - |
| QLQ56_RS08670 (QLQ56_08670) | - | 1795826..1796026 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ56_RS08675 (QLQ56_08675) | - | 1796031..1796672 (-) | 642 | WP_010717044.1 | putative HNHc nuclease | - |
| QLQ56_RS08680 (QLQ56_08680) | - | 1796677..1797411 (-) | 735 | WP_002381724.1 | ERF family protein | - |
| QLQ56_RS08685 (QLQ56_08685) | - | 1797404..1797721 (-) | 318 | WP_002401330.1 | hypothetical protein | - |
| QLQ56_RS08690 (QLQ56_08690) | - | 1797941..1798495 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ56_RS08695 (QLQ56_08695) | - | 1798922..1799116 (-) | 195 | WP_002381722.1 | hypothetical protein | - |
| QLQ56_RS08700 (QLQ56_08700) | - | 1799153..1799362 (-) | 210 | WP_002381721.1 | hypothetical protein | - |
| QLQ56_RS08705 (QLQ56_08705) | - | 1799417..1799605 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ56_RS08710 (QLQ56_08710) | - | 1799631..1800356 (-) | 726 | WP_002381720.1 | phage regulatory protein | - |
| QLQ56_RS08715 (QLQ56_08715) | - | 1800395..1800706 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ56_RS08720 (QLQ56_08720) | - | 1800717..1800893 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QLQ56_RS08725 (QLQ56_08725) | - | 1801205..1801537 (+) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| QLQ56_RS08730 (QLQ56_08730) | - | 1801554..1801898 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ56_RS08735 (QLQ56_08735) | - | 1801934..1802662 (+) | 729 | WP_002381717.1 | potassium channel family protein | - |
| QLQ56_RS08740 (QLQ56_08740) | - | 1802762..1803910 (+) | 1149 | WP_002381716.1 | site-specific integrase | - |
| QLQ56_RS08745 (QLQ56_08745) | comGD | 1803938..1804381 (-) | 444 | WP_002381715.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ56_RS08750 (QLQ56_08750) | comGC/cglC | 1804378..1804653 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=829390 QLQ56_RS08750 WP_002356991.1 1804378..1804653(-) (comGC/cglC) [Enterococcus faecalis strain EfsC12]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829390 QLQ56_RS08750 WP_002356991.1 1804378..1804653(-) (comGC/cglC) [Enterococcus faecalis strain EfsC12]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |