Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ37_RS08000 | Genome accession | NZ_CP124914 |
| Coordinates | 1663126..1663401 (-) | Length | 91 a.a. |
| NCBI ID | WP_002366896.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain EfsC8 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1658126..1668401
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ37_RS07965 (QLQ37_07965) | - | 1658688..1659161 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ37_RS07970 (QLQ37_07970) | - | 1659266..1660453 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ37_RS07975 (QLQ37_07975) | - | 1660478..1661485 (-) | 1008 | WP_033600640.1 | class I SAM-dependent methyltransferase | - |
| QLQ37_RS07980 (QLQ37_07980) | comGG | 1661614..1661967 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ37_RS07985 (QLQ37_07985) | comGF | 1661967..1662401 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ37_RS07990 (QLQ37_07990) | - | 1662391..1662717 (-) | 327 | WP_002419696.1 | type II secretion system protein | - |
| QLQ37_RS07995 (QLQ37_07995) | comGD | 1662683..1663129 (-) | 447 | WP_002419697.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ37_RS08000 (QLQ37_08000) | comGC/cglC | 1663126..1663401 (-) | 276 | WP_002366896.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ37_RS08005 (QLQ37_08005) | comGB | 1663401..1664447 (-) | 1047 | WP_033600639.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ37_RS08010 (QLQ37_08010) | comGA | 1664404..1665372 (-) | 969 | WP_002374519.1 | competence type IV pilus ATPase ComGA | - |
| QLQ37_RS08015 (QLQ37_08015) | - | 1665615..1666943 (-) | 1329 | WP_010816624.1 | amino acid permease | - |
| QLQ37_RS08020 (QLQ37_08020) | rlmN | 1667234..1668307 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10492.43 Da Isoelectric Point: 9.3340
>NTDB_id=829278 QLQ37_RS08000 WP_002366896.1 1663126..1663401(-) (comGC/cglC) [Enterococcus faecalis strain EfsC8]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829278 QLQ37_RS08000 WP_002366896.1 1663126..1663401(-) (comGC/cglC) [Enterococcus faecalis strain EfsC8]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTGGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAGGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAACAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTGGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAGGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAACAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |