Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ32_RS05710 | Genome accession | NZ_CP124913 |
| Coordinates | 1222466..1222741 (+) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain EfsC20 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1222765..1276232 | 1222466..1222741 | flank | 24 |
Gene organization within MGE regions
Location: 1222466..1276232
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ32_RS05710 (QLQ32_05710) | comGC/cglC | 1222466..1222741 (+) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ32_RS05715 (QLQ32_05715) | comGD | 1222738..1223181 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ32_RS05720 (QLQ32_05720) | - | 1223209..1224357 (-) | 1149 | WP_002389015.1 | site-specific integrase | - |
| QLQ32_RS05725 (QLQ32_05725) | - | 1224432..1224761 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| QLQ32_RS05730 (QLQ32_05730) | - | 1224776..1225540 (-) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| QLQ32_RS05735 (QLQ32_05735) | - | 1225658..1226305 (-) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ32_RS05740 (QLQ32_05740) | - | 1226310..1226654 (-) | 345 | WP_002384346.1 | helix-turn-helix transcriptional regulator | - |
| QLQ32_RS05745 (QLQ32_05745) | - | 1226945..1227136 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| QLQ32_RS05750 (QLQ32_05750) | - | 1227142..1227459 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| QLQ32_RS05755 (QLQ32_05755) | - | 1227498..1228220 (+) | 723 | WP_002364225.1 | phage regulatory protein | - |
| QLQ32_RS05760 (QLQ32_05760) | - | 1228260..1228442 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| QLQ32_RS05765 (QLQ32_05765) | - | 1228495..1228689 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| QLQ32_RS05770 (QLQ32_05770) | - | 1228680..1228865 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| QLQ32_RS05775 (QLQ32_05775) | - | 1228909..1229232 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| QLQ32_RS05780 (QLQ32_05780) | - | 1229232..1229459 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| QLQ32_RS05785 (QLQ32_05785) | - | 1229557..1230498 (+) | 942 | WP_002384348.1 | lambda-exonuclease family protein | - |
| QLQ32_RS05790 (QLQ32_05790) | - | 1230501..1231391 (+) | 891 | WP_002364218.1 | recombinase RecT | - |
| QLQ32_RS05795 (QLQ32_05795) | - | 1231405..1232372 (+) | 968 | Protein_1139 | Lin1244/Lin1753 domain-containing protein | - |
| QLQ32_RS05800 (QLQ32_05800) | - | 1232376..1232678 (+) | 303 | WP_002364215.1 | hypothetical protein | - |
| QLQ32_RS05805 (QLQ32_05805) | - | 1232679..1232978 (+) | 300 | WP_002364213.1 | MazG-like family protein | - |
| QLQ32_RS05810 (QLQ32_05810) | - | 1232996..1233419 (+) | 424 | Protein_1142 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ32_RS05815 (QLQ32_05815) | - | 1234326..1234742 (+) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ32_RS05825 (QLQ32_05825) | - | 1235273..1235887 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| QLQ32_RS05830 (QLQ32_05830) | - | 1236604..1237308 (+) | 705 | WP_002384357.1 | DUF5677 domain-containing protein | - |
| QLQ32_RS05835 (QLQ32_05835) | terS | 1237372..1238175 (+) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| QLQ32_RS05840 (QLQ32_05840) | - | 1238147..1239436 (+) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| QLQ32_RS05845 (QLQ32_05845) | - | 1239448..1240935 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| QLQ32_RS05850 (QLQ32_05850) | - | 1240910..1242667 (+) | 1758 | WP_002384360.1 | head protein | - |
| QLQ32_RS05855 (QLQ32_05855) | - | 1242664..1242885 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| QLQ32_RS05860 (QLQ32_05860) | - | 1242950..1243270 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| QLQ32_RS05865 (QLQ32_05865) | - | 1243488..1244111 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| QLQ32_RS05870 (QLQ32_05870) | - | 1244125..1245012 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QLQ32_RS05875 (QLQ32_05875) | - | 1245041..1245223 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| QLQ32_RS05880 (QLQ32_05880) | - | 1245237..1245581 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| QLQ32_RS05885 (QLQ32_05885) | - | 1245578..1245946 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| QLQ32_RS14065 | - | 1245939..1246022 (+) | 84 | Protein_1157 | HK97 gp10 family phage protein | - |
| QLQ32_RS05890 (QLQ32_05890) | - | 1246160..1247410 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ32_RS05895 (QLQ32_05895) | - | 1247764..1248108 (+) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| QLQ32_RS05900 (QLQ32_05900) | - | 1248111..1248485 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| QLQ32_RS05905 (QLQ32_05905) | - | 1248486..1249334 (+) | 849 | WP_002384363.1 | major tail protein | - |
| QLQ32_RS05910 (QLQ32_05910) | - | 1249387..1249737 (+) | 351 | WP_002357039.1 | hypothetical protein | - |
| QLQ32_RS05915 (QLQ32_05915) | - | 1249985..1252882 (+) | 2898 | Protein_1163 | tape measure protein | - |
| QLQ32_RS05920 (QLQ32_05920) | - | 1252872..1253606 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| QLQ32_RS05925 (QLQ32_05925) | - | 1253588..1256395 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| QLQ32_RS05930 (QLQ32_05930) | - | 1256414..1257295 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| QLQ32_RS05935 (QLQ32_05935) | - | 1257288..1257884 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| QLQ32_RS05940 (QLQ32_05940) | - | 1257881..1258168 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| QLQ32_RS05945 (QLQ32_05945) | - | 1258168..1258659 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| QLQ32_RS05950 (QLQ32_05950) | - | 1258673..1258993 (+) | 321 | WP_010774127.1 | hypothetical protein | - |
| QLQ32_RS05955 (QLQ32_05955) | - | 1258995..1259150 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| QLQ32_RS05960 (QLQ32_05960) | - | 1259185..1259406 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| QLQ32_RS05965 (QLQ32_05965) | - | 1259399..1259632 (+) | 234 | WP_002384371.1 | phage holin | - |
| QLQ32_RS05970 (QLQ32_05970) | - | 1259633..1260874 (+) | 1242 | WP_002384372.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ32_RS05975 (QLQ32_05975) | - | 1261739..1261939 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ32_RS05980 (QLQ32_05980) | - | 1262011..1262283 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| QLQ32_RS05990 (QLQ32_05990) | hemH | 1262999..1263940 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ32_RS05995 (QLQ32_05995) | - | 1264742..1265068 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ32_RS06000 (QLQ32_06000) | comGF | 1265058..1265492 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ32_RS06005 (QLQ32_06005) | comGG | 1265492..1265845 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ32_RS06010 (QLQ32_06010) | - | 1265974..1266981 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ32_RS06015 (QLQ32_06015) | - | 1267006..1268193 (+) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ32_RS06020 (QLQ32_06020) | - | 1268305..1268778 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ32_RS06025 (QLQ32_06025) | - | 1268956..1269234 (-) | 279 | WP_002380425.1 | hypothetical protein | - |
| QLQ32_RS06035 (QLQ32_06035) | - | 1269562..1270839 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| QLQ32_RS06040 (QLQ32_06040) | - | 1270968..1271645 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| QLQ32_RS06045 (QLQ32_06045) | - | 1271602..1272087 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| QLQ32_RS06050 (QLQ32_06050) | prmA | 1272103..1273050 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| QLQ32_RS06055 (QLQ32_06055) | - | 1273052..1273804 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| QLQ32_RS06060 (QLQ32_06060) | - | 1274019..1276232 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=829238 QLQ32_RS05710 WP_002364235.1 1222466..1222741(+) (comGC/cglC) [Enterococcus faecalis strain EfsC20]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829238 QLQ32_RS05710 WP_002364235.1 1222466..1222741(+) (comGC/cglC) [Enterococcus faecalis strain EfsC20]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |