Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ53_RS09275 | Genome accession | NZ_CP124911 |
| Coordinates | 1848443..1848718 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsC61 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1805240..1848419 | 1848443..1848718 | flank | 24 |
Gene organization within MGE regions
Location: 1805240..1848718
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ53_RS08975 (QLQ53_08975) | - | 1805240..1806247 (-) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
| QLQ53_RS08980 (QLQ53_08980) | comGG | 1806376..1806729 (-) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ53_RS08985 (QLQ53_08985) | comGF | 1806729..1807163 (-) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ53_RS08990 (QLQ53_08990) | - | 1807153..1807554 (-) | 402 | WP_014862199.1 | type II secretion system protein | - |
| QLQ53_RS08995 (QLQ53_08995) | - | 1807858..1807983 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| QLQ53_RS09000 (QLQ53_09000) | hemH | 1808280..1809221 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| QLQ53_RS09010 (QLQ53_09010) | - | 1809965..1810216 (-) | 252 | WP_002364188.1 | hypothetical protein | - |
| QLQ53_RS09015 (QLQ53_09015) | - | 1810288..1810488 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ53_RS09020 (QLQ53_09020) | - | 1811325..1812566 (-) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ53_RS09025 (QLQ53_09025) | - | 1812567..1812800 (-) | 234 | WP_002384371.1 | phage holin | - |
| QLQ53_RS09030 (QLQ53_09030) | - | 1812793..1813014 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| QLQ53_RS09035 (QLQ53_09035) | - | 1813049..1813204 (-) | 156 | WP_002394568.1 | XkdX family protein | - |
| QLQ53_RS09040 (QLQ53_09040) | - | 1813206..1813526 (-) | 321 | WP_002394569.1 | hypothetical protein | - |
| QLQ53_RS09045 (QLQ53_09045) | - | 1813545..1814087 (-) | 543 | WP_002394570.1 | hypothetical protein | - |
| QLQ53_RS09050 (QLQ53_09050) | - | 1814087..1814374 (-) | 288 | WP_002394572.1 | hypothetical protein | - |
| QLQ53_RS09055 (QLQ53_09055) | - | 1814371..1814967 (-) | 597 | WP_025191462.1 | hypothetical protein | - |
| QLQ53_RS09060 (QLQ53_09060) | - | 1814960..1815841 (-) | 882 | WP_010729977.1 | phage baseplate upper protein | - |
| QLQ53_RS09065 (QLQ53_09065) | - | 1815860..1818667 (-) | 2808 | WP_025191463.1 | phage tail spike protein | - |
| QLQ53_RS09070 (QLQ53_09070) | - | 1818649..1819383 (-) | 735 | WP_002380434.1 | hypothetical protein | - |
| QLQ53_RS09075 (QLQ53_09075) | - | 1819373..1822270 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| QLQ53_RS09080 (QLQ53_09080) | - | 1822518..1822868 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| QLQ53_RS09085 (QLQ53_09085) | - | 1822921..1823769 (-) | 849 | WP_002387287.1 | major tail protein | - |
| QLQ53_RS09090 (QLQ53_09090) | - | 1823770..1824144 (-) | 375 | WP_002393979.1 | DUF6838 family protein | - |
| QLQ53_RS09095 (QLQ53_09095) | - | 1824147..1824545 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| QLQ53_RS09100 (QLQ53_09100) | - | 1824538..1824906 (-) | 369 | WP_002393978.1 | hypothetical protein | - |
| QLQ53_RS09105 (QLQ53_09105) | - | 1824903..1825247 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| QLQ53_RS09110 (QLQ53_09110) | - | 1825261..1825443 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| QLQ53_RS09115 (QLQ53_09115) | - | 1825472..1826359 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QLQ53_RS09120 (QLQ53_09120) | - | 1826373..1826996 (-) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| QLQ53_RS09125 (QLQ53_09125) | - | 1827215..1827535 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| QLQ53_RS09130 (QLQ53_09130) | - | 1827592..1827822 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| QLQ53_RS09135 (QLQ53_09135) | - | 1827823..1829727 (-) | 1905 | WP_002393613.1 | hypothetical protein | - |
| QLQ53_RS09140 (QLQ53_09140) | - | 1829702..1831189 (-) | 1488 | WP_002393614.1 | phage portal protein | - |
| QLQ53_RS09145 (QLQ53_09145) | - | 1831201..1832490 (-) | 1290 | WP_002393615.1 | PBSX family phage terminase large subunit | - |
| QLQ53_RS09150 (QLQ53_09150) | terS | 1832462..1833265 (-) | 804 | WP_002372038.1 | phage terminase small subunit | - |
| QLQ53_RS09155 (QLQ53_09155) | - | 1833312..1834028 (-) | 717 | WP_002372040.1 | hypothetical protein | - |
| QLQ53_RS09160 (QLQ53_09160) | - | 1834121..1834348 (-) | 228 | WP_002372042.1 | hypothetical protein | - |
| QLQ53_RS09170 (QLQ53_09170) | - | 1836446..1836862 (-) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ53_RS09175 (QLQ53_09175) | - | 1837769..1838203 (-) | 435 | WP_002372046.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ53_RS09180 (QLQ53_09180) | - | 1838212..1838511 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| QLQ53_RS09185 (QLQ53_09185) | - | 1838512..1838814 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| QLQ53_RS09190 (QLQ53_09190) | - | 1838818..1839780 (-) | 963 | WP_002372048.1 | Lin1244/Lin1753 domain-containing protein | - |
| QLQ53_RS09195 (QLQ53_09195) | - | 1839794..1840684 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| QLQ53_RS09200 (QLQ53_09200) | - | 1840687..1841628 (-) | 942 | WP_002364219.1 | lambda-exonuclease family protein | - |
| QLQ53_RS09205 (QLQ53_09205) | - | 1841726..1841953 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| QLQ53_RS09210 (QLQ53_09210) | - | 1841953..1842276 (-) | 324 | WP_002380444.1 | hypothetical protein | - |
| QLQ53_RS09215 (QLQ53_09215) | - | 1842320..1842505 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| QLQ53_RS09220 (QLQ53_09220) | - | 1842496..1842690 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| QLQ53_RS09225 (QLQ53_09225) | - | 1842743..1842925 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| QLQ53_RS09230 (QLQ53_09230) | - | 1842965..1843687 (-) | 723 | WP_002364225.1 | phage regulatory protein | - |
| QLQ53_RS09235 (QLQ53_09235) | - | 1843726..1844043 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| QLQ53_RS09240 (QLQ53_09240) | - | 1844049..1844240 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| QLQ53_RS09245 (QLQ53_09245) | - | 1844530..1844874 (+) | 345 | WP_002385819.1 | helix-turn-helix transcriptional regulator | - |
| QLQ53_RS09250 (QLQ53_09250) | - | 1844879..1845526 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ53_RS09255 (QLQ53_09255) | - | 1845644..1846408 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| QLQ53_RS09260 (QLQ53_09260) | - | 1846423..1846752 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| QLQ53_RS09265 (QLQ53_09265) | - | 1846827..1847975 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| QLQ53_RS09270 (QLQ53_09270) | comGD | 1848003..1848446 (-) | 444 | WP_002369912.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ53_RS09275 (QLQ53_09275) | comGC/cglC | 1848443..1848718 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=829204 QLQ53_RS09275 WP_002356991.1 1848443..1848718(-) (comGC/cglC) [Enterococcus faecalis strain EfsC61]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829204 QLQ53_RS09275 WP_002356991.1 1848443..1848718(-) (comGC/cglC) [Enterococcus faecalis strain EfsC61]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |