Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ59_RS08490 | Genome accession | NZ_CP124906 |
| Coordinates | 1723668..1723943 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsC49 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1683655..1742049 | 1723668..1723943 | within | 0 |
Gene organization within MGE regions
Location: 1683655..1742049
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ59_RS08225 (QLQ59_08225) | - | 1683655..1684662 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ59_RS08230 (QLQ59_08230) | comGG | 1684791..1685144 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ59_RS08235 (QLQ59_08235) | comGF | 1685144..1685578 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ59_RS08240 (QLQ59_08240) | - | 1685568..1685939 (-) | 372 | WP_002365830.1 | type II secretion system protein | - |
| QLQ59_RS08245 (QLQ59_08245) | hemH | 1686696..1687637 (-) | 942 | WP_033628510.1 | ferrochelatase | - |
| QLQ59_RS08255 (QLQ59_08255) | - | 1688380..1688631 (-) | 252 | WP_002364188.1 | hypothetical protein | - |
| QLQ59_RS08260 (QLQ59_08260) | - | 1688704..1688904 (-) | 201 | WP_010783753.1 | cold-shock protein | - |
| QLQ59_RS08265 (QLQ59_08265) | - | 1689740..1690999 (-) | 1260 | WP_010783754.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ59_RS08270 (QLQ59_08270) | - | 1691053..1691451 (-) | 399 | WP_002358058.1 | phage holin family protein | - |
| QLQ59_RS08275 (QLQ59_08275) | - | 1691481..1692017 (-) | 537 | WP_002397775.1 | hypothetical protein | - |
| QLQ59_RS08280 (QLQ59_08280) | - | 1692018..1693046 (-) | 1029 | WP_002397774.1 | hypothetical protein | - |
| QLQ59_RS08285 (QLQ59_08285) | - | 1693057..1694181 (-) | 1125 | WP_002381461.1 | siphovirus ReqiPepy6 Gp37-like family protein | - |
| QLQ59_RS08290 (QLQ59_08290) | - | 1694184..1695083 (-) | 900 | WP_002371567.1 | phage tail domain-containing protein | - |
| QLQ59_RS08295 (QLQ59_08295) | - | 1695083..1699834 (-) | 4752 | WP_010783756.1 | phage tail tape measure protein | - |
| QLQ59_RS08300 (QLQ59_08300) | - | 1699853..1699975 (-) | 123 | WP_258078087.1 | hypothetical protein | - |
| QLQ59_RS08305 (QLQ59_08305) | - | 1700056..1700403 (-) | 348 | WP_010783757.1 | hypothetical protein | - |
| QLQ59_RS08310 (QLQ59_08310) | - | 1700460..1700933 (-) | 474 | WP_113816989.1 | Ig-like domain-containing protein | - |
| QLQ59_RS08315 (QLQ59_08315) | - | 1701007..1701600 (-) | 594 | WP_282874079.1 | major tail protein | - |
| QLQ59_RS08320 (QLQ59_08320) | - | 1701633..1702028 (-) | 396 | WP_010783759.1 | hypothetical protein | - |
| QLQ59_RS08325 (QLQ59_08325) | - | 1702025..1702429 (-) | 405 | WP_010783760.1 | hypothetical protein | - |
| QLQ59_RS08330 (QLQ59_08330) | - | 1702426..1702800 (-) | 375 | WP_002404844.1 | hypothetical protein | - |
| QLQ59_RS08335 (QLQ59_08335) | - | 1702787..1703092 (-) | 306 | WP_002358075.1 | hypothetical protein | - |
| QLQ59_RS08340 (QLQ59_08340) | - | 1703170..1704315 (-) | 1146 | WP_010783761.1 | phage major capsid protein | - |
| QLQ59_RS08345 (QLQ59_08345) | - | 1704342..1705109 (-) | 768 | WP_025192979.1 | head maturation protease, ClpP-related | - |
| QLQ59_RS08350 (QLQ59_08350) | - | 1705087..1706262 (-) | 1176 | WP_010784026.1 | phage portal protein | - |
| QLQ59_RS08355 (QLQ59_08355) | - | 1706525..1708204 (-) | 1680 | WP_010783765.1 | terminase TerL endonuclease subunit | - |
| QLQ59_RS08360 (QLQ59_08360) | - | 1708201..1708512 (-) | 312 | WP_002358082.1 | P27 family phage terminase small subunit | - |
| QLQ59_RS08365 (QLQ59_08365) | - | 1708605..1709276 (-) | 672 | WP_002371590.1 | HNH endonuclease | - |
| QLQ59_RS08370 (QLQ59_08370) | - | 1709395..1709709 (-) | 315 | WP_025192980.1 | HNH endonuclease | - |
| QLQ59_RS08375 (QLQ59_08375) | - | 1709706..1710035 (-) | 330 | WP_010783766.1 | hypothetical protein | - |
| QLQ59_RS08380 (QLQ59_08380) | - | 1710108..1710854 (-) | 747 | WP_010783767.1 | hypothetical protein | - |
| QLQ59_RS08385 (QLQ59_08385) | - | 1711230..1711697 (-) | 468 | WP_010783768.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ59_RS08390 (QLQ59_08390) | - | 1712360..1712566 (-) | 207 | WP_016633422.1 | hypothetical protein | - |
| QLQ59_RS08395 (QLQ59_08395) | - | 1712582..1713187 (-) | 606 | WP_010709305.1 | hypothetical protein | - |
| QLQ59_RS08400 (QLQ59_08400) | - | 1713207..1713677 (-) | 471 | WP_010709304.1 | DUF1064 domain-containing protein | - |
| QLQ59_RS08405 (QLQ59_08405) | - | 1713826..1714095 (-) | 270 | WP_010706851.1 | hypothetical protein | - |
| QLQ59_RS08410 (QLQ59_08410) | - | 1714234..1715073 (-) | 840 | WP_010783769.1 | ATP-binding protein | - |
| QLQ59_RS08415 (QLQ59_08415) | - | 1715085..1715840 (-) | 756 | WP_002391449.1 | DnaD domain protein | - |
| QLQ59_RS08420 (QLQ59_08420) | - | 1715855..1716670 (-) | 816 | WP_010783770.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| QLQ59_RS08425 (QLQ59_08425) | - | 1716633..1717649 (-) | 1017 | WP_010783771.1 | RecT family recombinase | - |
| QLQ59_RS08430 (QLQ59_08430) | - | 1717752..1717976 (-) | 225 | WP_002391454.1 | hypothetical protein | - |
| QLQ59_RS08435 (QLQ59_08435) | - | 1717973..1718296 (-) | 324 | WP_010783772.1 | hypothetical protein | - |
| QLQ59_RS08440 (QLQ59_08440) | - | 1718336..1718551 (-) | 216 | WP_010783773.1 | hypothetical protein | - |
| QLQ59_RS08445 (QLQ59_08445) | - | 1718558..1718869 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ59_RS08450 (QLQ59_08450) | - | 1718880..1719056 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QLQ59_RS08455 (QLQ59_08455) | - | 1719368..1719700 (+) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| QLQ59_RS08460 (QLQ59_08460) | - | 1719717..1720061 (+) | 345 | WP_002364356.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ59_RS08465 (QLQ59_08465) | - | 1720155..1721060 (+) | 906 | WP_016630909.1 | DUF4352 domain-containing protein | - |
| QLQ59_RS08470 (QLQ59_08470) | - | 1721120..1721194 (+) | 75 | Protein_1643 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ59_RS08475 (QLQ59_08475) | - | 1721228..1721956 (+) | 729 | WP_002364358.1 | potassium channel family protein | - |
| QLQ59_RS08480 (QLQ59_08480) | - | 1722052..1723200 (+) | 1149 | WP_010783774.1 | site-specific integrase | - |
| QLQ59_RS08485 (QLQ59_08485) | comGD | 1723228..1723671 (-) | 444 | WP_025189979.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ59_RS08490 (QLQ59_08490) | comGC/cglC | 1723668..1723943 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ59_RS08495 (QLQ59_08495) | comGB | 1723943..1724989 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ59_RS08500 (QLQ59_08500) | comGA | 1724946..1725914 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| QLQ59_RS08505 (QLQ59_08505) | - | 1726155..1727483 (-) | 1329 | WP_002356988.1 | amino acid permease | - |
| QLQ59_RS08510 (QLQ59_08510) | rlmN | 1727773..1728846 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QLQ59_RS08515 (QLQ59_08515) | - | 1728972..1730801 (-) | 1830 | WP_002392355.1 | ABC transporter permease | - |
| QLQ59_RS08520 (QLQ59_08520) | - | 1730791..1731540 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| QLQ59_RS08525 (QLQ59_08525) | - | 1731658..1732359 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| QLQ59_RS08530 (QLQ59_08530) | - | 1732489..1734912 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| QLQ59_RS08535 (QLQ59_08535) | - | 1735226..1736437 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QLQ59_RS08540 (QLQ59_08540) | - | 1736466..1737371 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| QLQ59_RS08545 (QLQ59_08545) | - | 1737493..1738473 (+) | 981 | WP_002356979.1 | polyprenyl synthetase family protein | - |
| QLQ59_RS08550 (QLQ59_08550) | cydC | 1738553..1740319 (-) | 1767 | WP_002364368.1 | thiol reductant ABC exporter subunit CydC | - |
| QLQ59_RS08555 (QLQ59_08555) | cydD | 1740316..1742049 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=829129 QLQ59_RS08490 WP_002356991.1 1723668..1723943(-) (comGC/cglC) [Enterococcus faecalis strain EfsC49]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829129 QLQ59_RS08490 WP_002356991.1 1723668..1723943(-) (comGC/cglC) [Enterococcus faecalis strain EfsC49]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |