Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ41_RS05475 | Genome accession | NZ_CP124905 |
| Coordinates | 1192609..1192884 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsC85 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1192908..1241784 | 1192609..1192884 | flank | 24 |
Gene organization within MGE regions
Location: 1192609..1241784
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ41_RS05475 (QLQ41_05475) | comGC/cglC | 1192609..1192884 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ41_RS05480 (QLQ41_05480) | comGD | 1192881..1193315 (+) | 435 | Protein_1077 | competence type IV pilus minor pilin ComGD | - |
| QLQ41_RS05485 (QLQ41_05485) | - | 1193352..1194500 (-) | 1149 | WP_002378469.1 | site-specific integrase | - |
| QLQ41_RS05490 (QLQ41_05490) | - | 1194600..1195328 (-) | 729 | WP_002378468.1 | potassium channel family protein | - |
| QLQ41_RS05495 (QLQ41_05495) | - | 1195364..1195708 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ41_RS05500 (QLQ41_05500) | - | 1195725..1196057 (-) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| QLQ41_RS05505 (QLQ41_05505) | - | 1196369..1196545 (+) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QLQ41_RS05510 (QLQ41_05510) | - | 1196556..1196867 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ41_RS05515 (QLQ41_05515) | - | 1196906..1197631 (+) | 726 | WP_002378466.1 | phage regulatory protein | - |
| QLQ41_RS05520 (QLQ41_05520) | - | 1197657..1197845 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ41_RS05525 (QLQ41_05525) | - | 1197900..1198109 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| QLQ41_RS05530 (QLQ41_05530) | - | 1198146..1198340 (+) | 195 | WP_002378464.1 | hypothetical protein | - |
| QLQ41_RS05535 (QLQ41_05535) | - | 1198767..1199321 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ41_RS05540 (QLQ41_05540) | - | 1199541..1199858 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ41_RS05545 (QLQ41_05545) | - | 1199851..1200585 (+) | 735 | WP_002378463.1 | ERF family protein | - |
| QLQ41_RS05550 (QLQ41_05550) | - | 1200590..1201231 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| QLQ41_RS05555 (QLQ41_05555) | - | 1201236..1201436 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ41_RS05560 (QLQ41_05560) | - | 1201436..1202293 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| QLQ41_RS05565 (QLQ41_05565) | - | 1202290..1202697 (+) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ41_RS05570 (QLQ41_05570) | - | 1203605..1204021 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ41_RS05580 (QLQ41_05580) | - | 1204736..1205644 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| QLQ41_RS05585 (QLQ41_05585) | - | 1205761..1206123 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| QLQ41_RS05590 (QLQ41_05590) | - | 1206594..1206824 (+) | 231 | Protein_1098 | hypothetical protein | - |
| QLQ41_RS05595 (QLQ41_05595) | - | 1206856..1207290 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ41_RS05600 (QLQ41_05600) | - | 1207271..1208554 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| QLQ41_RS05605 (QLQ41_05605) | - | 1208554..1210038 (+) | 1485 | WP_002378458.1 | phage portal protein | - |
| QLQ41_RS05610 (QLQ41_05610) | - | 1210031..1210957 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| QLQ41_RS05615 (QLQ41_05615) | - | 1211080..1211715 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| QLQ41_RS05620 (QLQ41_05620) | - | 1211729..1212625 (+) | 897 | WP_002378455.1 | hypothetical protein | - |
| QLQ41_RS05625 (QLQ41_05625) | - | 1212696..1213028 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ41_RS05630 (QLQ41_05630) | - | 1213025..1213300 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| QLQ41_RS05635 (QLQ41_05635) | - | 1213297..1213635 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ41_RS05640 (QLQ41_05640) | - | 1213632..1214024 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| QLQ41_RS05645 (QLQ41_05645) | - | 1214043..1214648 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| QLQ41_RS05650 (QLQ41_05650) | - | 1214651..1214833 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| QLQ41_RS05655 (QLQ41_05655) | - | 1214882..1215454 (+) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| QLQ41_RS05660 (QLQ41_05660) | - | 1215508..1215906 (+) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| QLQ41_RS05665 (QLQ41_05665) | - | 1215975..1216280 (+) | 306 | WP_002366371.1 | hypothetical protein | - |
| QLQ41_RS05670 (QLQ41_05670) | - | 1216267..1220721 (+) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| QLQ41_RS05675 (QLQ41_05675) | - | 1220718..1221440 (+) | 723 | WP_282897411.1 | hypothetical protein | - |
| QLQ41_RS05680 (QLQ41_05680) | - | 1221440..1222885 (+) | 1446 | WP_282897412.1 | phage tail spike protein | - |
| QLQ41_RS05685 (QLQ41_05685) | - | 1222891..1223631 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| QLQ41_RS05690 (QLQ41_05690) | - | 1223648..1224100 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ41_RS05695 (QLQ41_05695) | - | 1224119..1224514 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ41_RS05700 (QLQ41_05700) | - | 1224516..1224638 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ41_RS05705 (QLQ41_05705) | - | 1224649..1225029 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ41_RS05710 (QLQ41_05710) | - | 1225042..1226301 (+) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ41_RS05715 (QLQ41_05715) | - | 1227154..1227354 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ41_RS05720 (QLQ41_05720) | - | 1227426..1227698 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ41_RS05730 (QLQ41_05730) | hemH | 1228414..1229355 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ41_RS05735 (QLQ41_05735) | - | 1230156..1230482 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ41_RS05740 (QLQ41_05740) | comGF | 1230472..1230906 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ41_RS05745 (QLQ41_05745) | comGG | 1230906..1231259 (+) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ41_RS05750 (QLQ41_05750) | - | 1231388..1232395 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ41_RS05755 (QLQ41_05755) | - | 1232420..1233607 (+) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ41_RS05760 (QLQ41_05760) | - | 1233719..1234192 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ41_RS05765 (QLQ41_05765) | - | 1234508..1234840 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| QLQ41_RS05775 (QLQ41_05775) | - | 1235114..1236391 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| QLQ41_RS05780 (QLQ41_05780) | - | 1236520..1237197 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| QLQ41_RS05785 (QLQ41_05785) | - | 1237154..1237639 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| QLQ41_RS05790 (QLQ41_05790) | prmA | 1237655..1238602 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| QLQ41_RS05795 (QLQ41_05795) | - | 1238604..1239356 (+) | 753 | WP_002378439.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| QLQ41_RS05800 (QLQ41_05800) | - | 1239571..1241784 (+) | 2214 | WP_282897413.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=829088 QLQ41_RS05475 WP_002356991.1 1192609..1192884(+) (comGC/cglC) [Enterococcus faecalis strain EfsC85]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=829088 QLQ41_RS05475 WP_002356991.1 1192609..1192884(+) (comGC/cglC) [Enterococcus faecalis strain EfsC85]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |