Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ52_RS05780 | Genome accession | NZ_CP124898 |
| Coordinates | 1234461..1234736 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsC109-2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1234760..1283636 | 1234461..1234736 | flank | 24 |
Gene organization within MGE regions
Location: 1234461..1283636
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ52_RS05780 (QLQ52_05780) | comGC/cglC | 1234461..1234736 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ52_RS05785 (QLQ52_05785) | comGD | 1234733..1235167 (+) | 435 | Protein_1137 | competence type IV pilus minor pilin ComGD | - |
| QLQ52_RS05790 (QLQ52_05790) | - | 1235204..1236352 (-) | 1149 | WP_002378469.1 | site-specific integrase | - |
| QLQ52_RS05795 (QLQ52_05795) | - | 1236452..1237180 (-) | 729 | WP_002378468.1 | potassium channel family protein | - |
| QLQ52_RS05800 (QLQ52_05800) | - | 1237216..1237560 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ52_RS05805 (QLQ52_05805) | - | 1237577..1237909 (-) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| QLQ52_RS05810 (QLQ52_05810) | - | 1238221..1238397 (+) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QLQ52_RS05815 (QLQ52_05815) | - | 1238408..1238719 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ52_RS05820 (QLQ52_05820) | - | 1238758..1239483 (+) | 726 | WP_002378466.1 | phage regulatory protein | - |
| QLQ52_RS05825 (QLQ52_05825) | - | 1239509..1239697 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ52_RS05830 (QLQ52_05830) | - | 1239752..1239961 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| QLQ52_RS05835 (QLQ52_05835) | - | 1239998..1240192 (+) | 195 | WP_002378464.1 | hypothetical protein | - |
| QLQ52_RS05840 (QLQ52_05840) | - | 1240619..1241173 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ52_RS05845 (QLQ52_05845) | - | 1241393..1241710 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ52_RS05850 (QLQ52_05850) | - | 1241703..1242437 (+) | 735 | WP_002378463.1 | ERF family protein | - |
| QLQ52_RS05855 (QLQ52_05855) | - | 1242442..1243083 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| QLQ52_RS05860 (QLQ52_05860) | - | 1243088..1243288 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ52_RS05865 (QLQ52_05865) | - | 1243288..1244145 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| QLQ52_RS05870 (QLQ52_05870) | - | 1244142..1244549 (+) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ52_RS05875 (QLQ52_05875) | - | 1245457..1245873 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ52_RS05885 (QLQ52_05885) | - | 1246588..1247496 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| QLQ52_RS05890 (QLQ52_05890) | - | 1247613..1247975 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| QLQ52_RS05895 (QLQ52_05895) | - | 1248446..1248676 (+) | 231 | Protein_1158 | hypothetical protein | - |
| QLQ52_RS05900 (QLQ52_05900) | - | 1248708..1249142 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ52_RS05905 (QLQ52_05905) | - | 1249123..1250406 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| QLQ52_RS05910 (QLQ52_05910) | - | 1250406..1251890 (+) | 1485 | WP_002378458.1 | phage portal protein | - |
| QLQ52_RS05915 (QLQ52_05915) | - | 1251883..1252809 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| QLQ52_RS05920 (QLQ52_05920) | - | 1252932..1253567 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| QLQ52_RS05925 (QLQ52_05925) | - | 1253581..1254477 (+) | 897 | WP_002378455.1 | hypothetical protein | - |
| QLQ52_RS05930 (QLQ52_05930) | - | 1254548..1254880 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ52_RS05935 (QLQ52_05935) | - | 1254877..1255152 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| QLQ52_RS05940 (QLQ52_05940) | - | 1255149..1255487 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ52_RS05945 (QLQ52_05945) | - | 1255484..1255876 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| QLQ52_RS05950 (QLQ52_05950) | - | 1255895..1256500 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| QLQ52_RS05955 (QLQ52_05955) | - | 1256503..1256685 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| QLQ52_RS05960 (QLQ52_05960) | - | 1256734..1257306 (+) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| QLQ52_RS05965 (QLQ52_05965) | - | 1257360..1257758 (+) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| QLQ52_RS05970 (QLQ52_05970) | - | 1257827..1258132 (+) | 306 | WP_002366371.1 | hypothetical protein | - |
| QLQ52_RS05975 (QLQ52_05975) | - | 1258119..1262573 (+) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| QLQ52_RS05980 (QLQ52_05980) | - | 1262570..1263292 (+) | 723 | WP_002363380.1 | hypothetical protein | - |
| QLQ52_RS05985 (QLQ52_05985) | - | 1263292..1264737 (+) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| QLQ52_RS05990 (QLQ52_05990) | - | 1264743..1265483 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| QLQ52_RS05995 (QLQ52_05995) | - | 1265500..1265952 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ52_RS06000 (QLQ52_06000) | - | 1265971..1266366 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ52_RS06005 (QLQ52_06005) | - | 1266368..1266490 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ52_RS06010 (QLQ52_06010) | - | 1266501..1266881 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ52_RS06015 (QLQ52_06015) | - | 1266894..1268153 (+) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ52_RS06020 (QLQ52_06020) | - | 1269006..1269206 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ52_RS06025 (QLQ52_06025) | - | 1269278..1269550 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ52_RS06035 (QLQ52_06035) | hemH | 1270266..1271207 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ52_RS06040 (QLQ52_06040) | - | 1272008..1272334 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ52_RS06045 (QLQ52_06045) | comGF | 1272324..1272758 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ52_RS06050 (QLQ52_06050) | comGG | 1272758..1273111 (+) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ52_RS06055 (QLQ52_06055) | - | 1273240..1274247 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ52_RS06060 (QLQ52_06060) | - | 1274272..1275459 (+) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ52_RS06065 (QLQ52_06065) | - | 1275571..1276044 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ52_RS06070 (QLQ52_06070) | - | 1276360..1276692 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| QLQ52_RS06080 (QLQ52_06080) | - | 1276966..1278243 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| QLQ52_RS06085 (QLQ52_06085) | - | 1278372..1279049 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| QLQ52_RS06090 (QLQ52_06090) | - | 1279006..1279491 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| QLQ52_RS06095 (QLQ52_06095) | prmA | 1279507..1280454 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| QLQ52_RS06100 (QLQ52_06100) | - | 1280456..1281208 (+) | 753 | WP_002378439.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| QLQ52_RS06105 (QLQ52_06105) | - | 1281423..1283636 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=828978 QLQ52_RS05780 WP_002356991.1 1234461..1234736(+) (comGC/cglC) [Enterococcus faecalis strain EfsC109-2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=828978 QLQ52_RS05780 WP_002356991.1 1234461..1234736(+) (comGC/cglC) [Enterococcus faecalis strain EfsC109-2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |