Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ38_RS08565 | Genome accession | NZ_CP124890 |
| Coordinates | 1774105..1774380 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsPF2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1769105..1779380
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ38_RS08530 (QLQ38_08530) | - | 1769660..1770133 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| QLQ38_RS08535 (QLQ38_08535) | - | 1770245..1771432 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ38_RS08540 (QLQ38_08540) | - | 1771457..1772464 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ38_RS08545 (QLQ38_08545) | comGG | 1772593..1772946 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ38_RS08550 (QLQ38_08550) | comGF | 1772946..1773380 (-) | 435 | WP_010824786.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ38_RS08555 (QLQ38_08555) | - | 1773370..1773696 (-) | 327 | WP_010824787.1 | type II secretion system protein | - |
| QLQ38_RS08560 (QLQ38_08560) | comGD | 1773662..1774108 (-) | 447 | WP_048949289.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ38_RS08565 (QLQ38_08565) | comGC/cglC | 1774105..1774380 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ38_RS08570 (QLQ38_08570) | comGB | 1774380..1775426 (-) | 1047 | WP_010824788.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ38_RS08575 (QLQ38_08575) | comGA | 1775383..1776351 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| QLQ38_RS08580 (QLQ38_08580) | - | 1776593..1777921 (-) | 1329 | WP_002360022.1 | amino acid permease | - |
| QLQ38_RS08585 (QLQ38_08585) | rlmN | 1778212..1779285 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=828832 QLQ38_RS08565 WP_002356991.1 1774105..1774380(-) (comGC/cglC) [Enterococcus faecalis strain EfsPF2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=828832 QLQ38_RS08565 WP_002356991.1 1774105..1774380(-) (comGC/cglC) [Enterococcus faecalis strain EfsPF2]
ATGAAAAAGAAACAAAAATACGCAGGATTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGATTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |