Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ46_RS05840 | Genome accession | NZ_CP124887 |
| Coordinates | 1214566..1214841 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsPNK7 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1209566..1219841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ46_RS05820 (QLQ46_05820) | rlmN | 1209663..1210736 (+) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QLQ46_RS05825 (QLQ46_05825) | - | 1211026..1212354 (+) | 1329 | WP_002360022.1 | amino acid permease | - |
| QLQ46_RS05830 (QLQ46_05830) | comGA | 1212595..1213563 (+) | 969 | WP_010710572.1 | competence type IV pilus ATPase ComGA | - |
| QLQ46_RS05835 (QLQ46_05835) | comGB | 1213520..1214566 (+) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ46_RS05840 (QLQ46_05840) | comGC/cglC | 1214566..1214841 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ46_RS05845 (QLQ46_05845) | comGD | 1214838..1215284 (+) | 447 | WP_078122739.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ46_RS05850 (QLQ46_05850) | - | 1215250..1215576 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| QLQ46_RS05855 (QLQ46_05855) | comGF | 1215566..1216000 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ46_RS05860 (QLQ46_05860) | comGG | 1216000..1216353 (+) | 354 | WP_010710571.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ46_RS05865 (QLQ46_05865) | - | 1216482..1217489 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QLQ46_RS05870 (QLQ46_05870) | - | 1217514..1218701 (+) | 1188 | WP_002357064.1 | acetate kinase | - |
| QLQ46_RS05875 (QLQ46_05875) | - | 1218813..1219286 (-) | 474 | WP_002357065.1 | universal stress protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=828748 QLQ46_RS05840 WP_002356991.1 1214566..1214841(+) (comGC/cglC) [Enterococcus faecalis strain EfsPNK7]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=828748 QLQ46_RS05840 WP_002356991.1 1214566..1214841(+) (comGC/cglC) [Enterococcus faecalis strain EfsPNK7]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |