Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QLQ60_RS08960 | Genome accession | NZ_CP124882 |
| Coordinates | 1810481..1810756 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain EfsPF20 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1768899..1828863 | 1810481..1810756 | within | 0 |
Gene organization within MGE regions
Location: 1768899..1828863
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ60_RS08680 (QLQ60_08680) | - | 1768899..1769906 (-) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
| QLQ60_RS08685 (QLQ60_08685) | comGG | 1770035..1770388 (-) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| QLQ60_RS08690 (QLQ60_08690) | comGF | 1770388..1770822 (-) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| QLQ60_RS08695 (QLQ60_08695) | - | 1770812..1771138 (-) | 327 | WP_002390369.1 | type II secretion system protein | - |
| QLQ60_RS08700 (QLQ60_08700) | hemH | 1771940..1772881 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| QLQ60_RS08710 (QLQ60_08710) | - | 1773597..1773869 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| QLQ60_RS08715 (QLQ60_08715) | - | 1773941..1774141 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| QLQ60_RS08720 (QLQ60_08720) | - | 1774988..1776247 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QLQ60_RS08725 (QLQ60_08725) | - | 1776644..1777894 (+) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| QLQ60_RS08730 (QLQ60_08730) | - | 1778031..1778411 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| QLQ60_RS08735 (QLQ60_08735) | - | 1778422..1778544 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| QLQ60_RS08740 (QLQ60_08740) | - | 1778546..1778941 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| QLQ60_RS08745 (QLQ60_08745) | - | 1778960..1779412 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| QLQ60_RS08750 (QLQ60_08750) | - | 1779429..1780169 (-) | 741 | WP_025193093.1 | hypothetical protein | - |
| QLQ60_RS08755 (QLQ60_08755) | - | 1780175..1781620 (-) | 1446 | WP_010712603.1 | phage tail spike protein | - |
| QLQ60_RS08760 (QLQ60_08760) | - | 1781620..1782342 (-) | 723 | WP_010785045.1 | hypothetical protein | - |
| QLQ60_RS08765 (QLQ60_08765) | - | 1782339..1786793 (-) | 4455 | WP_010785046.1 | phage tail tape measure protein | - |
| QLQ60_RS08770 (QLQ60_08770) | - | 1786780..1787085 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| QLQ60_RS08775 (QLQ60_08775) | - | 1787154..1787552 (-) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| QLQ60_RS08780 (QLQ60_08780) | - | 1787615..1787923 (-) | 309 | WP_010785047.1 | hypothetical protein | - |
| QLQ60_RS08785 (QLQ60_08785) | - | 1787926..1788531 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| QLQ60_RS08790 (QLQ60_08790) | - | 1788550..1788942 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| QLQ60_RS08795 (QLQ60_08795) | - | 1788939..1789277 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QLQ60_RS08800 (QLQ60_08800) | - | 1789274..1789549 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| QLQ60_RS08805 (QLQ60_08805) | - | 1789546..1789878 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| QLQ60_RS08810 (QLQ60_08810) | - | 1789949..1790845 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| QLQ60_RS08815 (QLQ60_08815) | - | 1790859..1791494 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| QLQ60_RS08820 (QLQ60_08820) | - | 1791617..1792543 (-) | 927 | WP_010785048.1 | minor capsid protein | - |
| QLQ60_RS08825 (QLQ60_08825) | - | 1792536..1794020 (-) | 1485 | WP_010785049.1 | phage portal protein | - |
| QLQ60_RS08830 (QLQ60_08830) | - | 1794020..1795303 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| QLQ60_RS08835 (QLQ60_08835) | - | 1795284..1795718 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| QLQ60_RS08840 (QLQ60_08840) | - | 1795750..1795980 (-) | 231 | Protein_1715 | hypothetical protein | - |
| QLQ60_RS08845 (QLQ60_08845) | - | 1796451..1796813 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| QLQ60_RS08850 (QLQ60_08850) | - | 1796930..1797838 (-) | 909 | WP_002378460.1 | hypothetical protein | - |
| QLQ60_RS08860 (QLQ60_08860) | - | 1798553..1798969 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QLQ60_RS08865 (QLQ60_08865) | - | 1799876..1800283 (-) | 408 | WP_024797260.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QLQ60_RS08870 (QLQ60_08870) | - | 1800280..1801137 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| QLQ60_RS08875 (QLQ60_08875) | - | 1801137..1801337 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| QLQ60_RS08880 (QLQ60_08880) | - | 1801342..1801983 (-) | 642 | WP_002357009.1 | putative HNHc nuclease | - |
| QLQ60_RS08885 (QLQ60_08885) | - | 1801988..1802722 (-) | 735 | WP_002385820.1 | ERF family protein | - |
| QLQ60_RS08890 (QLQ60_08890) | - | 1802715..1803032 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ60_RS08895 (QLQ60_08895) | - | 1803252..1803806 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ60_RS08900 (QLQ60_08900) | - | 1804091..1804429 (-) | 339 | WP_002357003.1 | hypothetical protein | - |
| QLQ60_RS08905 (QLQ60_08905) | - | 1804466..1804675 (-) | 210 | WP_002357002.1 | hypothetical protein | - |
| QLQ60_RS08910 (QLQ60_08910) | - | 1804730..1804918 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ60_RS08915 (QLQ60_08915) | - | 1804944..1805666 (-) | 723 | WP_002357000.1 | phage regulatory protein | - |
| QLQ60_RS08920 (QLQ60_08920) | - | 1805689..1806000 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ60_RS14710 | - | 1806012..1806179 (-) | 168 | WP_002388204.1 | hypothetical protein | - |
| QLQ60_RS08925 (QLQ60_08925) | - | 1806597..1806794 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| QLQ60_RS08930 (QLQ60_08930) | - | 1806807..1806989 (-) | 183 | WP_002388205.1 | hypothetical protein | - |
| QLQ60_RS08935 (QLQ60_08935) | - | 1807281..1807616 (+) | 336 | WP_002388206.1 | helix-turn-helix transcriptional regulator | - |
| QLQ60_RS08940 (QLQ60_08940) | - | 1807635..1807979 (+) | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QLQ60_RS08945 (QLQ60_08945) | - | 1808037..1808765 (+) | 729 | WP_002388208.1 | potassium channel family protein | - |
| QLQ60_RS08950 (QLQ60_08950) | - | 1808865..1810013 (+) | 1149 | WP_002388210.1 | site-specific integrase | - |
| QLQ60_RS08955 (QLQ60_08955) | comGD | 1810041..1810484 (-) | 444 | WP_016617790.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ60_RS08960 (QLQ60_08960) | comGC/cglC | 1810481..1810756 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QLQ60_RS08965 (QLQ60_08965) | comGB | 1810756..1811802 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ60_RS08970 (QLQ60_08970) | comGA | 1811759..1812727 (-) | 969 | WP_002369168.1 | competence type IV pilus ATPase ComGA | - |
| QLQ60_RS08975 (QLQ60_08975) | - | 1812969..1814297 (-) | 1329 | WP_002360022.1 | amino acid permease | - |
| QLQ60_RS08980 (QLQ60_08980) | rlmN | 1814587..1815660 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| QLQ60_RS08985 (QLQ60_08985) | - | 1815786..1817615 (-) | 1830 | WP_002391458.1 | ABC transporter permease | - |
| QLQ60_RS08990 (QLQ60_08990) | - | 1817605..1818354 (-) | 750 | WP_002372053.1 | ABC transporter ATP-binding protein | - |
| QLQ60_RS08995 (QLQ60_08995) | - | 1818472..1819173 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| QLQ60_RS09000 (QLQ60_09000) | - | 1819303..1821726 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| QLQ60_RS09005 (QLQ60_09005) | - | 1822040..1823251 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QLQ60_RS09010 (QLQ60_09010) | - | 1823280..1824185 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| QLQ60_RS09015 (QLQ60_09015) | - | 1824307..1825287 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| QLQ60_RS09020 (QLQ60_09020) | cydC | 1825367..1827133 (-) | 1767 | WP_002369917.1 | thiol reductant ABC exporter subunit CydC | - |
| QLQ60_RS09025 (QLQ60_09025) | cydD | 1827130..1828863 (-) | 1734 | WP_002369918.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=828643 QLQ60_RS08960 WP_002356991.1 1810481..1810756(-) (comGC/cglC) [Enterococcus faecalis strain EfsPF20]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=828643 QLQ60_RS08960 WP_002356991.1 1810481..1810756(-) (comGC/cglC) [Enterococcus faecalis strain EfsPF20]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |