Detailed information NTG0812549

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QA608_RS04575
• Genome accession: NZ_CP121502
• Coordinates: 982731..983048 (-)
• Length: 105 a.a.
• NCBI ID: WP_001831271.1
• Uniprot ID: A0A9Q5JKE9
• Organism: Staphylococcus epidermidis strain 24FSE01
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 977731..988048

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QA608_RS04545	gcvPA	978257..979603 (-)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
QA608_RS04550	gcvT	979623..980714 (-)	1092	WP_001831107.1	glycine cleavage system aminomethyltransferase GcvT	-
QA608_RS04555	-	980932..981444 (-)	513	WP_002440040.1	shikimate kinase	-
QA608_RS04560	-	981609..982100 (-)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
QA608_RS04565	-	982024..982317 (-)	294	WP_001831116.1	hypothetical protein	-
QA608_RS04570	comGD	982304..982741 (-)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
QA608_RS04575	comGC	982731..983048 (-)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
QA608_RS04580	comGB	983066..984133 (-)	1068	WP_001831131.1	competence type IV pilus assembly protein ComGB	Machinery gene
QA608_RS04585	comGA	984105..985079 (-)	975	WP_151368235.1	competence type IV pilus ATPase ComGA	Machinery gene
QA608_RS04590	-	985136..985759 (-)	624	WP_278269668.1	MBL fold metallo-hydrolase	-
QA608_RS04595	-	985759..986085 (-)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
QA608_RS04600	-	986085..987071 (-)	987	WP_001831113.1	ROK family glucokinase	-
QA608_RS04605	-	987071..987271 (-)	201	WP_001831138.1	YqgQ family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=812549 QA608_RS04575 WP_001831271.1 982731..983048(-) (comGC) [Staphylococcus epidermidis strain 24FSE01]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=812549 QA608_RS04575 WP_001831271.1 982731..983048(-) (comGC) [Staphylococcus epidermidis strain 24FSE01]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362