NTDB

Overview

Name	ssb	Type	Machinery gene
Locus tag	P8P68_RS03990	Genome accession	NZ_CP121467
Coordinates	823043..823513 (-)	Length	156 a.a.
NCBI ID	WP_000609592.1	Uniprot ID	A0AAX3TKJ9
Organism	Streptococcus sp. D7B5
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 818043..828513

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P8P68_RS03960 (P8P68_03960)	-	818049..819359 (-)	1311	WP_278276218.1	glycosyltransferase	-
P8P68_RS03965 (P8P68_03965)	-	819352..819492 (-)	141	WP_000176306.1	hypothetical protein	-
P8P68_RS03970 (P8P68_03970)	-	819502..820281 (-)	780	WP_278276219.1	hypothetical protein	-
P8P68_RS03975 (P8P68_03975)	wecB	820288..821436 (-)	1149	WP_278276220.1	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	-
P8P68_RS03980 (P8P68_03980)	-	821876..822385 (-)	510	WP_278276221.1	GNAT family N-acetyltransferase	-
P8P68_RS03985 (P8P68_03985)	rpsR	822772..823011 (-)	240	WP_000068664.1	30S ribosomal protein S18	-
P8P68_RS03990 (P8P68_03990)	ssb	823043..823513 (-)	471	WP_000609592.1	single-stranded DNA-binding protein SsbA	Machinery gene
P8P68_RS03995 (P8P68_03995)	rpsF	823525..823815 (-)	291	WP_278276222.1	30S ribosomal protein S6	-
P8P68_RS04000 (P8P68_04000)	asnS	823964..825310 (-)	1347	WP_278276300.1	asparagine--tRNA ligase	-
P8P68_RS04005 (P8P68_04005)	-	825460..826638 (-)	1179	WP_278276223.1	pyridoxal phosphate-dependent aminotransferase	-
P8P68_RS04010 (P8P68_04010)	-	826648..827124 (-)	477	WP_000776857.1	DUF5590 domain-containing protein	-
P8P68_RS04015 (P8P68_04015)	-	827243..827689 (+)	447	WP_000816316.1	MarR family transcriptional regulator	-
P8P68_RS04020 (P8P68_04020)	-	827781..828329 (+)	549	WP_000039627.1	NADPH-dependent FMN reductase	-

Sequence

Protein

Download Length: 156 a.a. Molecular weight: 17168.05 Da Isoelectric Point: 5.1957

                                >NTDB_id=812212 P8P68_RS03990 WP_000609592.1 823043..823513(-) (ssb) [Streptococcus sp. D7B5]

MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGITGRIQTR

SYDNQQGQRVYVTEVVADNFQMLESRGVREGHSGGAYSAPTAGQSAPANPVPDFSRSENPFGATNPLDISDDDLPF

Nucleotide

Download Length: 471 bp

                                >NTDB_id=812212 P8P68_RS03990 WP_000609592.1 823043..823513(-) (ssb) [Streptococcus sp. D7B5]

ATGATTAACAATGTTGTACTTGTAGGGCGTATGACGCGTGACGCTGAGTTGCGTTATACCCCATCAAATGTAGCAGTTGC

GACTTTTACTCTTGCAGTAAACCGTACATTTAAGAGTCAAAATGGCGAACGTGAGGCTGATTTTATCAATGTCGTTATGT

GGCGCCAACAAGCTGAAAATCTTGCTAACTGGGCTAAAAAAGGCTCTCTTATCGGGATCACAGGTCGTATTCAGACTCGA

AGTTACGATAACCAGCAAGGACAACGTGTTTACGTAACAGAAGTCGTGGCGGATAATTTCCAAATGTTGGAAAGCCGCGG

AGTGCGTGAAGGACATTCAGGTGGAGCTTATTCCGCACCAACTGCTGGTCAATCAGCACCTGCAAACCCAGTACCAGACT

TTTCACGTTCTGAAAATCCATTTGGAGCAACAAATCCATTGGACATTTCAGATGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssb	Latilactobacillus sakei subsp. sakei 23K	53.409	100	0.603
ssbA	Bacillus subtilis subsp. subtilis str. 168	54.651	100	0.603
ssb	Neisseria gonorrhoeae MS11	34.286	100	0.385
ssbB	Bacillus subtilis subsp. subtilis str. 168	55.66	67.949	0.378
ssbB/cilA	Streptococcus pneumoniae TIGR4	50.427	75	0.378
ssbB	Streptococcus sobrinus strain NIDR 6715-7	54.128	69.872	0.378
ssbB/cilA	Streptococcus pneumoniae Rx1	49.573	75	0.372
ssbB/cilA	Streptococcus pneumoniae D39	49.573	75	0.372
ssbB/cilA	Streptococcus pneumoniae R6	49.573	75	0.372
ssbB/cilA	Streptococcus mitis SK321	49.573	75	0.372
ssbB/cilA	Streptococcus mitis NCTC 12261	49.573	75	0.372
ssb	Neisseria meningitidis MC58	33.143	100	0.372

Detailed information NTG0812212