Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | ORD27_RS08750 | Genome accession | NZ_CP121233 |
| Coordinates | 1762556..1762831 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain SVJ-EF01 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1720021..1780937 | 1762556..1762831 | within | 0 |
Gene organization within MGE regions
Location: 1720021..1780937
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORD27_RS08455 (ORD27_008455) | - | 1720021..1721028 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| ORD27_RS08460 (ORD27_008460) | comGG | 1721157..1721510 (-) | 354 | WP_016618446.1 | competence type IV pilus minor pilin ComGG | - |
| ORD27_RS08465 (ORD27_008465) | comGF | 1721510..1721944 (-) | 435 | WP_010707381.1 | competence type IV pilus minor pilin ComGF | - |
| ORD27_RS08470 (ORD27_008470) | - | 1721934..1722305 (-) | 372 | WP_173962365.1 | type II secretion system protein | - |
| ORD27_RS08475 (ORD27_008475) | hemH | 1723061..1724002 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| ORD27_RS08485 (ORD27_008485) | - | 1724742..1724990 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| ORD27_RS08490 (ORD27_008490) | - | 1725062..1725262 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| ORD27_RS08495 (ORD27_008495) | - | 1726099..1727340 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ORD27_RS08500 (ORD27_008500) | - | 1727341..1727574 (-) | 234 | WP_002384371.1 | phage holin | - |
| ORD27_RS08505 (ORD27_008505) | - | 1727567..1727788 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| ORD27_RS08510 (ORD27_008510) | - | 1727823..1727978 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| ORD27_RS08515 (ORD27_008515) | - | 1727980..1728300 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| ORD27_RS08520 (ORD27_008520) | - | 1728314..1728805 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| ORD27_RS08525 (ORD27_008525) | - | 1728805..1729056 (-) | 252 | WP_014524854.1 | hypothetical protein | - |
| ORD27_RS08530 (ORD27_008530) | - | 1729053..1729649 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| ORD27_RS08535 (ORD27_008535) | - | 1729642..1730523 (-) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| ORD27_RS08540 (ORD27_008540) | - | 1730542..1733349 (-) | 2808 | WP_271865924.1 | phage tail spike protein | - |
| ORD27_RS08545 (ORD27_008545) | - | 1733331..1734065 (-) | 735 | WP_271865926.1 | phage tail protein | - |
| ORD27_RS08550 (ORD27_008550) | - | 1734055..1736952 (-) | 2898 | WP_002387288.1 | tape measure protein | - |
| ORD27_RS08555 (ORD27_008555) | - | 1737200..1737550 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| ORD27_RS08560 (ORD27_008560) | - | 1737603..1738451 (-) | 849 | WP_002387287.1 | major tail protein | - |
| ORD27_RS08565 (ORD27_008565) | - | 1738452..1738826 (-) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| ORD27_RS08570 (ORD27_008570) | - | 1738829..1739227 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| ORD27_RS08575 (ORD27_008575) | - | 1739220..1739594 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| ORD27_RS08580 (ORD27_008580) | - | 1739591..1739935 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| ORD27_RS08585 (ORD27_008585) | - | 1739949..1740131 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| ORD27_RS08590 (ORD27_008590) | - | 1740160..1741047 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| ORD27_RS08595 (ORD27_008595) | - | 1741061..1741684 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| ORD27_RS08600 (ORD27_008600) | - | 1741903..1742222 (-) | 320 | Protein_1666 | hypothetical protein | - |
| ORD27_RS08605 (ORD27_008605) | - | 1742279..1742509 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| ORD27_RS08610 (ORD27_008610) | - | 1742510..1744414 (-) | 1905 | WP_010714050.1 | SPP1 gp7 family phage head morphogenesis protein | - |
| ORD27_RS08615 (ORD27_008615) | - | 1744389..1745861 (-) | 1473 | WP_010706495.1 | phage portal protein | - |
| ORD27_RS08620 (ORD27_008620) | terL | 1745873..1747261 (-) | 1389 | WP_002387276.1 | phage terminase large subunit | - |
| ORD27_RS08625 (ORD27_008625) | - | 1747254..1747715 (-) | 462 | WP_002383816.1 | helix-turn-helix domain-containing protein | - |
| ORD27_RS08630 (ORD27_008630) | - | 1747791..1747967 (-) | 177 | WP_010706496.1 | hypothetical protein | - |
| ORD27_RS08635 (ORD27_008635) | - | 1748151..1748963 (-) | 813 | WP_002387275.1 | hypothetical protein | - |
| ORD27_RS08640 (ORD27_008640) | - | 1749075..1749308 (-) | 234 | Protein_1674 | hypothetical protein | - |
| ORD27_RS08645 (ORD27_008645) | - | 1749892..1750362 (-) | 471 | WP_002383811.1 | hypothetical protein | - |
| ORD27_RS08650 (ORD27_008650) | - | 1750387..1751310 (-) | 924 | WP_002383810.1 | DUF6731 family protein | - |
| ORD27_RS08660 (ORD27_008660) | - | 1752028..1752444 (-) | 417 | WP_010706497.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ORD27_RS08665 (ORD27_008665) | - | 1753352..1753760 (-) | 409 | Protein_1678 | RusA family crossover junction endodeoxyribonuclease | - |
| ORD27_RS08670 (ORD27_008670) | - | 1753757..1754614 (-) | 858 | WP_002387271.1 | helix-turn-helix domain-containing protein | - |
| ORD27_RS08675 (ORD27_008675) | - | 1754614..1754814 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| ORD27_RS08680 (ORD27_008680) | - | 1754819..1755460 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| ORD27_RS08685 (ORD27_008685) | - | 1755465..1756199 (-) | 735 | WP_002383799.1 | ERF family protein | - |
| ORD27_RS08690 (ORD27_008690) | - | 1756192..1756509 (-) | 318 | WP_002383798.1 | hypothetical protein | - |
| ORD27_RS08695 (ORD27_008695) | - | 1756705..1757043 (-) | 339 | WP_002383796.1 | hypothetical protein | - |
| ORD27_RS08700 (ORD27_008700) | - | 1757080..1757289 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| ORD27_RS08705 (ORD27_008705) | - | 1757344..1757532 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| ORD27_RS08710 (ORD27_008710) | - | 1757558..1758280 (-) | 723 | WP_002387270.1 | phage regulatory protein | - |
| ORD27_RS08715 (ORD27_008715) | - | 1758303..1758614 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| ORD27_RS08720 (ORD27_008720) | - | 1758626..1758817 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| ORD27_RS08725 (ORD27_008725) | - | 1759113..1759454 (+) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| ORD27_RS08730 (ORD27_008730) | - | 1759459..1760109 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ORD27_RS08735 (ORD27_008735) | - | 1760205..1760834 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| ORD27_RS08740 (ORD27_008740) | - | 1760940..1762088 (+) | 1149 | WP_002387264.1 | site-specific integrase | - |
| ORD27_RS08745 (ORD27_008745) | comGD | 1762125..1762559 (-) | 435 | Protein_1694 | competence type IV pilus minor pilin ComGD | - |
| ORD27_RS08750 (ORD27_008750) | comGC/cglC | 1762556..1762831 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ORD27_RS08755 (ORD27_008755) | comGB | 1762831..1763877 (-) | 1047 | WP_104846628.1 | competence type IV pilus assembly protein ComGB | - |
| ORD27_RS08760 (ORD27_008760) | comGA | 1763834..1764802 (-) | 969 | WP_085443259.1 | competence type IV pilus ATPase ComGA | - |
| ORD27_RS08765 (ORD27_008765) | - | 1765042..1766370 (-) | 1329 | WP_064687249.1 | amino acid permease | - |
| ORD27_RS08770 (ORD27_008770) | rlmN | 1766660..1767733 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| ORD27_RS08775 (ORD27_008775) | - | 1767859..1769688 (-) | 1830 | WP_010713274.1 | ABC transporter permease | - |
| ORD27_RS08780 (ORD27_008780) | - | 1769678..1770427 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| ORD27_RS08785 (ORD27_008785) | - | 1770545..1771246 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| ORD27_RS08790 (ORD27_008790) | - | 1771377..1773800 (-) | 2424 | WP_070415770.1 | DNA translocase FtsK | - |
| ORD27_RS08795 (ORD27_008795) | - | 1774114..1775325 (-) | 1212 | WP_002401320.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| ORD27_RS08800 (ORD27_008800) | - | 1775354..1776259 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| ORD27_RS08805 (ORD27_008805) | - | 1776381..1777361 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| ORD27_RS08810 (ORD27_008810) | cydC | 1777441..1779207 (-) | 1767 | WP_085443342.1 | thiol reductant ABC exporter subunit CydC | - |
| ORD27_RS08815 (ORD27_008815) | cydD | 1779204..1780937 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=811275 ORD27_RS08750 WP_002356991.1 1762556..1762831(-) (comGC/cglC) [Enterococcus faecalis strain SVJ-EF01]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=811275 ORD27_RS08750 WP_002356991.1 1762556..1762831(-) (comGC/cglC) [Enterococcus faecalis strain SVJ-EF01]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |