Detailed information NTG0080447

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: L6480_RS10750
• Genome accession: NZ_AP022981
• Coordinates: 2089230..2089565 (+)
• Length: 111 a.a.
• NCBI ID: WP_100651365.1
• Uniprot ID: -
• Organism: Bacillus cereus strain 30048
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2076705..2089565	2089230..2089565	within	0

Gene organization within MGE regions

Location: 2076705..2089565

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L6480_RS10690 (BC30048_2051)	-	2076705..2077748 (-)	1044	WP_011040467.1	collagen-like protein	-
L6480_RS10695 (BC30048_2052)	-	2077875..2078582 (-)	708	WP_001082941.1	CotZ-related putative spore coat protein	-
L6480_RS10700 (BC30048_2053)	-	2078910..2079290 (-)	381	WP_000205101.1	DUF6262 family protein	-
L6480_RS10705 (BC30048_2054)	-	2079283..2081388 (-)	2106	WP_000824133.1	tyrosine-type recombinase/integrase	-
L6480_RS10710 (BC30048_2055)	-	2081400..2082518 (-)	1119	WP_001265870.1	tyrosine-type recombinase/integrase	-
L6480_RS10715 (BC30048_2057)	-	2082979..2084052 (+)	1074	WP_000109855.1	tetratricopeptide repeat protein	-
L6480_RS10720 (BC30048_2058)	-	2084049..2084174 (+)	126	WP_000709201.1	aspartate phosphatase	-
L6480_RS10725 (BC30048_2060)	-	2084470..2085252 (-)	783	WP_000499732.1	hypothetical protein	-
L6480_RS10730 (BC30048_2061)	-	2085362..2086009 (+)	648	WP_000165966.1	HD domain-containing protein	-
L6480_RS10735 (BC30048_2062)	-	2086006..2087901 (+)	1896	WP_100651363.1	ABC-F family ATP-binding cassette domain-containing protein	-
L6480_RS10740 (BC30048_2063)	-	2087977..2088708 (+)	732	WP_001260655.1	Bax inhibitor-1/YccA family protein	-
L6480_RS10745 (BC30048_2064)	-	2088814..2089068 (+)	255	WP_000975138.1	DUF4318 domain-containing protein	-
L6480_RS10750 (BC30048_2065)	ssbA	2089230..2089565 (+)	336	WP_100651365.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12792.68 Da
• Isoelectric Point: 9.9193

>NTDB_id=80447 L6480_RS10750 WP_100651365.1 2089230..2089565(+) (ssbA) [Bacillus cereus strain 30048]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYHNEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 336 bp

>NTDB_id=80447 L6480_RS10750 WP_100651365.1 2089230..2089565(+) (ssbA) [Bacillus cereus strain 30048]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACCATAATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.434	95.495	0.568
ssb	Latilactobacillus sakei subsp. sakei 23K	56.604	95.495	0.541
ssbB	Bacillus subtilis subsp. subtilis str. 168	51.786	100	0.523
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.636	99.099	0.432
ssbB	Lactococcus lactis subsp. cremoris KW2	44.762	94.595	0.423
ssbA	Streptococcus mutans UA159	40	99.099	0.396
ssbB/cilA	Streptococcus mitis NCTC 12261	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae TIGR4	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae D39	39.091	99.099	0.387
ssbB/cilA	Streptococcus pneumoniae R6	39.091	99.099	0.387
ssbB/cilA	Streptococcus mitis SK321	39.091	99.099	0.387
ssbB/cilA	Streptococcus pneumoniae Rx1	39.091	99.099	0.387