Detailed information NTG0080246

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: L6484_RS10775
• Genome accession: NZ_AP022964
• Coordinates: 2125085..2125423 (+)
• Length: 112 a.a.
• NCBI ID: WP_200152291.1
• Uniprot ID: -
• Organism: Bacillus cereus strain J62
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	2123345..2124500	2125085..2125423	flank	585

Gene organization within MGE regions

Location: 2123345..2125423

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L6484_RS10765	-	2123345..2124500 (-)	1156	Protein_2054	IS3 family transposase	-
L6484_RS10770 (BCJMU62_2092)	-	2124676..2124930 (+)	255	WP_200152292.1	DUF4318 domain-containing protein	-
L6484_RS10775 (BCJMU62_2093)	ssbA	2125085..2125423 (+)	339	WP_200152291.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 112 a.a.
• Molecular weight: 12920.85 Da
• Isoelectric Point: 9.4226

>NTDB_id=80246 L6484_RS10775 WP_200152291.1 2125085..2125423(+) (ssbA) [Bacillus cereus strain J62]
MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIHTK
NYEDDQGKRIYITEVVIESITFLERRREGVSQ

Nucleotide

• Length: 339 bp

>NTDB_id=80246 L6484_RS10775 WP_200152291.1 2125085..2125423(+) (ssbA) [Bacillus cereus strain J62]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAGCAAGGCGTCGCGTATGC
ACGAGTATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTAGATTTTATAAATTGTGTCGTAT
GGCGAAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAAGGGTCTCTTGTTGGAATTACCGGACGTATTCATACGAAG
AATTACGAGGATGATCAAGGAAAGAGAATATATATAACGGAAGTCGTGATTGAGAGCATTACATTTTTGGAGAGAAGGCG
CGAAGGTGTATCGCAATAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	58.491	94.643	0.554
ssb	Latilactobacillus sakei subsp. sakei 23K	55.66	94.643	0.527
ssbB	Bacillus subtilis subsp. subtilis str. 168	50.943	94.643	0.482
ssbB	Lactococcus lactis subsp. cremoris KW2	47.619	93.75	0.446
ssbB	Streptococcus sobrinus strain NIDR 6715-7	45.283	94.643	0.429
ssbA	Streptococcus mutans UA159	43.396	94.643	0.411
ssbB/cilA	Streptococcus pneumoniae TIGR4	41.509	94.643	0.393
ssbB/cilA	Streptococcus mitis NCTC 12261	41.509	94.643	0.393
ssbB/cilA	Streptococcus pneumoniae D39	40.566	94.643	0.384
ssbB/cilA	Streptococcus pneumoniae R6	40.566	94.643	0.384
ssbB/cilA	Streptococcus pneumoniae Rx1	40.566	94.643	0.384
ssbB/cilA	Streptococcus mitis SK321	40.566	94.643	0.384