Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3K48_RS08695 | Genome accession | NZ_CP119705 |
| Coordinates | 1791093..1791506 (-) | Length | 137 a.a. |
| NCBI ID | WP_404968661.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET16-45 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1758987..1799319 | 1791093..1791506 | within | 0 |
Gene organization within MGE regions
Location: 1758987..1799319
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K48_RS08470 (P3K48_08385) | - | 1758987..1759742 (-) | 756 | WP_404968647.1 | CHAP domain-containing protein | - |
| P3K48_RS08475 (P3K48_08390) | - | 1759755..1760009 (-) | 255 | WP_096533858.1 | phage holin | - |
| P3K48_RS08480 (P3K48_08395) | - | 1760028..1761917 (-) | 1890 | WP_404968648.1 | glucosaminidase domain-containing protein | - |
| P3K48_RS08485 (P3K48_08400) | - | 1762040..1762414 (-) | 375 | WP_015728845.1 | hypothetical protein | - |
| P3K48_RS08490 (P3K48_08405) | - | 1762447..1763718 (-) | 1272 | WP_015728844.1 | phage baseplate upper protein | - |
| P3K48_RS08495 (P3K48_08410) | - | 1763735..1764778 (-) | 1044 | WP_189695453.1 | SGNH/GDSL hydrolase family protein | - |
| P3K48_RS08500 (P3K48_08415) | - | 1764790..1765482 (-) | 693 | WP_189695454.1 | hypothetical protein | - |
| P3K48_RS08505 (P3K48_08420) | - | 1765486..1766883 (-) | 1398 | WP_404968649.1 | phage tail protein | - |
| P3K48_RS08510 (P3K48_08425) | - | 1766896..1767828 (-) | 933 | WP_404968650.1 | phage tail domain-containing protein | - |
| P3K48_RS08515 (P3K48_08430) | - | 1767841..1770960 (-) | 3120 | WP_404968651.1 | phage tail protein | - |
| P3K48_RS08520 (P3K48_08435) | - | 1770977..1771327 (-) | 351 | WP_096536435.1 | hypothetical protein | - |
| P3K48_RS08525 (P3K48_08440) | - | 1771357..1771737 (-) | 381 | WP_096533868.1 | tail assembly chaperone | - |
| P3K48_RS08530 (P3K48_08445) | - | 1771797..1772450 (-) | 654 | WP_203163229.1 | phage major tail protein, TP901-1 family | - |
| P3K48_RS08535 (P3K48_08450) | - | 1772468..1772863 (-) | 396 | WP_063282647.1 | hypothetical protein | - |
| P3K48_RS08540 (P3K48_08455) | - | 1772875..1773225 (-) | 351 | WP_015728834.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3K48_RS08545 (P3K48_08460) | - | 1773527..1773859 (-) | 333 | WP_203163231.1 | phage head-tail connector protein | - |
| P3K48_RS08550 (P3K48_08465) | - | 1773871..1774320 (-) | 450 | WP_316644261.1 | Ig-like domain-containing protein | - |
| P3K48_RS08555 (P3K48_08470) | - | 1774410..1775321 (-) | 912 | WP_096533874.1 | capsid protein | - |
| P3K48_RS08560 (P3K48_08475) | - | 1775339..1775947 (-) | 609 | WP_037543590.1 | DUF4355 domain-containing protein | - |
| P3K48_RS08565 (P3K48_08480) | - | 1776100..1776294 (-) | 195 | WP_037543592.1 | hypothetical protein | - |
| P3K48_RS08570 (P3K48_08485) | - | 1776294..1777643 (-) | 1350 | WP_404968652.1 | minor capsid protein | - |
| P3K48_RS08575 (P3K48_08490) | - | 1777636..1779081 (-) | 1446 | WP_096533877.1 | phage portal protein | - |
| P3K48_RS08580 (P3K48_08495) | - | 1779093..1780367 (-) | 1275 | WP_404959960.1 | PBSX family phage terminase large subunit | - |
| P3K48_RS08585 (P3K48_08500) | - | 1780354..1780797 (-) | 444 | WP_103866922.1 | terminase small subunit | - |
| P3K48_RS08590 (P3K48_08505) | - | 1781084..1781509 (-) | 426 | WP_041614789.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| P3K48_RS08595 (P3K48_08510) | - | 1781510..1781653 (-) | 144 | WP_154800885.1 | hypothetical protein | - |
| P3K48_RS08600 (P3K48_08515) | rinB | 1781653..1781820 (-) | 168 | WP_110165025.1 | transcriptional activator RinB | - |
| P3K48_RS08605 (P3K48_08520) | - | 1781817..1782005 (-) | 189 | WP_096536203.1 | DUF1381 domain-containing protein | - |
| P3K48_RS08610 (P3K48_08525) | - | 1782042..1782548 (-) | 507 | WP_096536205.1 | dUTPase | - |
| P3K48_RS08615 (P3K48_08530) | - | 1782565..1782936 (-) | 372 | WP_096536207.1 | hypothetical protein | - |
| P3K48_RS08620 (P3K48_08535) | - | 1782938..1783279 (-) | 342 | WP_199633267.1 | hypothetical protein | - |
| P3K48_RS08625 (P3K48_08540) | - | 1783279..1783665 (-) | 387 | WP_404968653.1 | hypothetical protein | - |
| P3K48_RS08630 (P3K48_08545) | - | 1783665..1783913 (-) | 249 | WP_140230327.1 | hypothetical protein | - |
| P3K48_RS08635 (P3K48_08550) | dcm | 1783913..1785295 (-) | 1383 | WP_404968654.1 | DNA (cytosine-5-)-methyltransferase | - |
| P3K48_RS08640 (P3K48_08555) | - | 1785318..1785539 (-) | 222 | WP_140223637.1 | DUF3269 family protein | - |
| P3K48_RS08645 (P3K48_08560) | - | 1785536..1785724 (-) | 189 | WP_140223638.1 | hypothetical protein | - |
| P3K48_RS08650 (P3K48_08565) | - | 1785730..1786188 (-) | 459 | WP_404968655.1 | DUF3310 domain-containing protein | - |
| P3K48_RS08655 (P3K48_08570) | - | 1786349..1786669 (-) | 321 | WP_189695464.1 | hypothetical protein | - |
| P3K48_RS08660 (P3K48_08575) | - | 1786682..1786900 (-) | 219 | WP_404968656.1 | hypothetical protein | - |
| P3K48_RS08665 (P3K48_08580) | - | 1786884..1787324 (-) | 441 | WP_404968657.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3K48_RS08670 (P3K48_08585) | - | 1787526..1788770 (-) | 1245 | WP_404968658.1 | DnaB helicase C-terminal domain-containing protein | - |
| P3K48_RS08675 (P3K48_08590) | - | 1788763..1789110 (-) | 348 | WP_096533161.1 | hypothetical protein | - |
| P3K48_RS08680 (P3K48_08595) | - | 1789115..1789861 (-) | 747 | WP_404968659.1 | DnaD domain protein | - |
| P3K48_RS08685 (P3K48_08600) | - | 1789854..1790528 (-) | 675 | WP_404968660.1 | putative HNHc nuclease | - |
| P3K48_RS08690 (P3K48_08605) | - | 1790529..1791080 (-) | 552 | WP_099989996.1 | NUMOD4 motif-containing HNH endonuclease | - |
| P3K48_RS08695 (P3K48_08610) | ssbA | 1791093..1791506 (-) | 414 | WP_404968661.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K48_RS08700 (P3K48_08615) | - | 1791506..1792174 (-) | 669 | WP_015728804.1 | ERF family protein | - |
| P3K48_RS08705 (P3K48_08620) | - | 1792175..1792660 (-) | 486 | WP_275322495.1 | siphovirus Gp157 family protein | - |
| P3K48_RS08710 (P3K48_08625) | - | 1792644..1792868 (-) | 225 | WP_404968662.1 | hypothetical protein | - |
| P3K48_RS08715 (P3K48_08630) | - | 1792880..1793140 (-) | 261 | WP_103866957.1 | DUF1108 family protein | - |
| P3K48_RS08720 (P3K48_08635) | - | 1793400..1793723 (-) | 324 | WP_100008589.1 | DUF771 domain-containing protein | - |
| P3K48_RS08725 (P3K48_08640) | - | 1793790..1794029 (+) | 240 | WP_103866961.1 | hypothetical protein | - |
| P3K48_RS08730 (P3K48_08645) | - | 1794019..1794198 (-) | 180 | WP_103866963.1 | hypothetical protein | - |
| P3K48_RS08735 (P3K48_08650) | - | 1794555..1794818 (+) | 264 | WP_103866967.1 | CRISPR-associated endonuclease Cas2 | - |
| P3K48_RS08740 (P3K48_08655) | - | 1794822..1794983 (-) | 162 | WP_168434020.1 | hypothetical protein | - |
| P3K48_RS08745 (P3K48_08660) | - | 1794994..1795761 (-) | 768 | WP_103866969.1 | phage regulatory protein/antirepressor Ant | - |
| P3K48_RS08750 (P3K48_08665) | - | 1795817..1795984 (-) | 168 | WP_168434021.1 | hypothetical protein | - |
| P3K48_RS08755 (P3K48_08670) | - | 1795998..1796213 (-) | 216 | WP_065354506.1 | transcriptional regulator | - |
| P3K48_RS08760 (P3K48_08675) | - | 1796408..1797100 (+) | 693 | WP_065354507.1 | XRE family transcriptional regulator | - |
| P3K48_RS08765 (P3K48_08680) | - | 1797156..1797791 (+) | 636 | WP_404968663.1 | hypothetical protein | - |
| P3K48_RS08770 (P3K48_08685) | - | 1797848..1798873 (+) | 1026 | WP_404968664.1 | tyrosine-type recombinase/integrase | - |
| P3K48_RS08775 (P3K48_08690) | - | 1799122..1799319 (-) | 198 | WP_014614194.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15615.20 Da Isoelectric Point: 6.3425
>NTDB_id=800628 P3K48_RS08695 WP_404968661.1 1791093..1791506(-) (ssbA) [Staphylococcus pseudintermedius strain CUVET16-45]
MINRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDNVQFLESKSNGQSNSQAKQQQRQDNPFDNSDFDDSSLPF
MINRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDNVQFLESKSNGQSNSQAKQQQRQDNPFDNSDFDDSSLPF
Nucleotide
Download Length: 414 bp
>NTDB_id=800628 P3K48_RS08695 WP_404968661.1 1791093..1791506(-) (ssbA) [Staphylococcus pseudintermedius strain CUVET16-45]
ATGATCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCGGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAACGTGCAATTTTTAGAGTCTAAATC
TAATGGTCAATCGAACAGTCAAGCTAAACAACAACAAAGGCAGGACAATCCGTTTGATAACAGTGACTTTGATGACTCGT
CACTCCCGTTTTGA
ATGATCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCGGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAACGTGCAATTTTTAGAGTCTAAATC
TAATGGTCAATCGAACAGTCAAGCTAAACAACAACAAAGGCAGGACAATCCGTTTGATAACAGTGACTTTGATGACTCGT
CACTCCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
69.811 |
77.372 |
0.54 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
60.748 |
78.102 |
0.474 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
77.372 |
0.438 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.286 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.286 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.286 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.286 |
100 |
0.401 |
| ssb | Vibrio cholerae strain A1552 |
30.636 |
100 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.394 |
96.35 |
0.38 |
| ssbA | Streptococcus mutans UA159 |
37.956 |
100 |
0.38 |