Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3K40_RS02860 | Genome accession | NZ_CP119701 |
| Coordinates | 645828..646265 (+) | Length | 145 a.a. |
| NCBI ID | WP_199612914.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET17-667 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 627644..690973 | 645828..646265 | within | 0 |
Gene organization within MGE regions
Location: 627644..690973
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K40_RS02725 (P3K40_02655) | - | 627644..628222 (-) | 579 | WP_014613162.1 | CHAP domain-containing protein | - |
| P3K40_RS02730 (P3K40_02660) | - | 628893..629969 (+) | 1077 | WP_096533481.1 | NAD/NADP-dependent octopine/nopaline dehydrogenase family protein | - |
| P3K40_RS02735 (P3K40_02665) | nhaC | 629995..631392 (+) | 1398 | WP_037542391.1 | Na+/H+ antiporter NhaC | - |
| P3K40_RS02740 (P3K40_02670) | - | 631664..632140 (+) | 477 | WP_096533482.1 | hypothetical protein | - |
| P3K40_RS02745 (P3K40_02675) | - | 632304..633032 (-) | 729 | WP_015729537.1 | CHAP domain-containing protein | - |
| P3K40_RS02750 (P3K40_02680) | - | 633737..634789 (+) | 1053 | WP_096533483.1 | LLM class flavin-dependent oxidoreductase | - |
| P3K40_RS02755 (P3K40_02685) | - | 634803..635156 (+) | 354 | WP_096533484.1 | DoxX family protein | - |
| P3K40_RS02760 (P3K40_02690) | - | 635619..635966 (+) | 348 | WP_096533485.1 | transcriptional regulator, SarA/Rot family | - |
| P3K40_RS02765 (P3K40_02695) | - | 636405..637556 (+) | 1152 | WP_100004254.1 | acyl-CoA dehydrogenase family protein | - |
| P3K40_RS02770 (P3K40_02700) | - | 637585..638631 (-) | 1047 | WP_063282612.1 | tyrosine-type recombinase/integrase | - |
| P3K40_RS02775 (P3K40_02705) | - | 638695..639483 (-) | 789 | WP_100004255.1 | DUF1828 domain-containing protein | - |
| P3K40_RS02780 (P3K40_02710) | - | 639497..639952 (-) | 456 | WP_100004256.1 | DUF6978 family protein | - |
| P3K40_RS02785 (P3K40_02715) | - | 640000..640509 (-) | 510 | WP_222936263.1 | hypothetical protein | - |
| P3K40_RS02790 (P3K40_02720) | - | 640559..641281 (-) | 723 | WP_081247735.1 | XRE family transcriptional regulator | - |
| P3K40_RS02795 (P3K40_02725) | - | 641433..641645 (+) | 213 | WP_063282614.1 | helix-turn-helix transcriptional regulator | - |
| P3K40_RS02800 (P3K40_02730) | - | 641691..641852 (+) | 162 | WP_037543668.1 | hypothetical protein | - |
| P3K40_RS02805 (P3K40_02735) | - | 641856..642119 (-) | 264 | WP_037543667.1 | CRISPR-associated endonuclease Cas2 | - |
| P3K40_RS02810 (P3K40_02740) | - | 642176..642370 (+) | 195 | WP_015728796.1 | hypothetical protein | - |
| P3K40_RS02815 (P3K40_02745) | - | 642476..642643 (+) | 168 | WP_015728797.1 | hypothetical protein | - |
| P3K40_RS02820 (P3K40_02750) | - | 642640..642867 (-) | 228 | WP_060830240.1 | hypothetical protein | - |
| P3K40_RS02825 (P3K40_02755) | - | 642945..643688 (+) | 744 | WP_060830239.1 | BRO family protein | - |
| P3K40_RS02830 (P3K40_02760) | - | 643685..643909 (+) | 225 | WP_015728800.1 | hypothetical protein | - |
| P3K40_RS02835 (P3K40_02765) | - | 643897..644085 (+) | 189 | WP_065354752.1 | hypothetical protein | - |
| P3K40_RS02840 (P3K40_02770) | - | 644155..644415 (+) | 261 | WP_404959948.1 | DUF1108 family protein | - |
| P3K40_RS02845 (P3K40_02775) | - | 644427..644690 (+) | 264 | WP_404959950.1 | hypothetical protein | - |
| P3K40_RS02850 (P3K40_02780) | - | 644674..645159 (+) | 486 | WP_065354750.1 | siphovirus Gp157 family protein | - |
| P3K40_RS02855 (P3K40_02785) | - | 645160..645828 (+) | 669 | WP_015728804.1 | ERF family protein | - |
| P3K40_RS02860 (P3K40_02790) | ssbA | 645828..646265 (+) | 438 | WP_199612914.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K40_RS02865 (P3K40_02795) | - | 646246..646440 (+) | 195 | WP_096533900.1 | hypothetical protein | - |
| P3K40_RS02870 (P3K40_02800) | - | 646449..647120 (+) | 672 | WP_110164874.1 | putative HNHc nuclease | - |
| P3K40_RS02875 (P3K40_02805) | - | 647113..647826 (+) | 714 | WP_100002827.1 | helix-turn-helix domain-containing protein | - |
| P3K40_RS02880 (P3K40_02810) | - | 647836..648609 (+) | 774 | WP_100002825.1 | ATP-binding protein | - |
| P3K40_RS02885 (P3K40_02815) | - | 648603..648782 (+) | 180 | WP_096533894.1 | hypothetical protein | - |
| P3K40_RS02890 (P3K40_02820) | - | 648783..649217 (+) | 435 | WP_096533893.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3K40_RS02895 (P3K40_02825) | - | 649201..649419 (+) | 219 | WP_096533892.1 | hypothetical protein | - |
| P3K40_RS02900 (P3K40_02830) | - | 649432..649752 (+) | 321 | WP_096533891.1 | hypothetical protein | - |
| P3K40_RS02905 (P3K40_02835) | - | 649749..649913 (+) | 165 | WP_179292374.1 | hypothetical protein | - |
| P3K40_RS02910 (P3K40_02840) | - | 649913..650365 (+) | 453 | WP_096533890.1 | DUF3310 domain-containing protein | - |
| P3K40_RS02915 (P3K40_02845) | - | 650362..651321 (+) | 960 | WP_096533889.1 | DNA cytosine methyltransferase | - |
| P3K40_RS02920 (P3K40_02850) | - | 651392..651568 (+) | 177 | WP_019169002.1 | hypothetical protein | - |
| P3K40_RS02925 (P3K40_02855) | - | 651568..651954 (+) | 387 | WP_234985437.1 | hypothetical protein | - |
| P3K40_RS02930 (P3K40_02860) | - | 651954..652169 (+) | 216 | WP_103866929.1 | hypothetical protein | - |
| P3K40_RS02935 (P3K40_02865) | - | 652170..652430 (+) | 261 | WP_037542743.1 | hypothetical protein | - |
| P3K40_RS02940 (P3K40_02870) | - | 652507..652719 (+) | 213 | WP_233509998.1 | hypothetical protein | - |
| P3K40_RS02945 (P3K40_02875) | - | 652721..653092 (+) | 372 | WP_096533174.1 | hypothetical protein | - |
| P3K40_RS02950 (P3K40_02880) | - | 653111..653647 (+) | 537 | WP_203162917.1 | dUTPase | - |
| P3K40_RS02955 (P3K40_02885) | - | 653711..654175 (+) | 465 | WP_065354067.1 | class I SAM-dependent methyltransferase | - |
| P3K40_RS02960 (P3K40_02890) | - | 654172..654360 (+) | 189 | WP_096533882.1 | DUF1381 domain-containing protein | - |
| P3K40_RS02965 (P3K40_02895) | rinB | 654376..654546 (+) | 171 | WP_096533881.1 | transcriptional activator RinB | - |
| P3K40_RS02970 (P3K40_02900) | - | 654546..654698 (+) | 153 | WP_179292371.1 | hypothetical protein | - |
| P3K40_RS02975 (P3K40_02905) | - | 654701..655120 (+) | 420 | WP_065354588.1 | transcriptional regulator | - |
| P3K40_RS02980 (P3K40_02910) | - | 655319..655546 (+) | 228 | WP_096533880.1 | hypothetical protein | - |
| P3K40_RS02985 (P3K40_02915) | - | 655616..656059 (+) | 444 | WP_096533879.1 | terminase small subunit | - |
| P3K40_RS02990 (P3K40_02920) | - | 656046..657320 (+) | 1275 | WP_404959960.1 | PBSX family phage terminase large subunit | - |
| P3K40_RS02995 (P3K40_02925) | - | 657332..658777 (+) | 1446 | WP_404959962.1 | phage portal protein | - |
| P3K40_RS03000 (P3K40_02930) | - | 658770..660122 (+) | 1353 | WP_110144985.1 | minor capsid protein | - |
| P3K40_RS03005 (P3K40_02935) | - | 660119..660313 (+) | 195 | WP_096533876.1 | LSM domain protein | - |
| P3K40_RS03010 (P3K40_02940) | - | 660465..661073 (+) | 609 | WP_096533875.1 | DUF4355 domain-containing protein | - |
| P3K40_RS03015 (P3K40_02945) | - | 661091..662002 (+) | 912 | WP_096533874.1 | capsid protein | - |
| P3K40_RS03020 (P3K40_02950) | - | 662092..662541 (+) | 450 | WP_096533873.1 | Ig-like domain-containing protein | - |
| P3K40_RS03025 (P3K40_02955) | - | 662553..662885 (+) | 333 | WP_316635251.1 | phage head-tail connector protein | - |
| P3K40_RS03030 (P3K40_02960) | - | 663186..663536 (+) | 351 | WP_096533871.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3K40_RS03035 (P3K40_02965) | - | 663548..663943 (+) | 396 | WP_096533870.1 | hypothetical protein | - |
| P3K40_RS03040 (P3K40_02970) | - | 663961..664614 (+) | 654 | WP_096533869.1 | phage major tail protein, TP901-1 family | - |
| P3K40_RS03045 (P3K40_02975) | - | 664674..665054 (+) | 381 | WP_096533868.1 | tail assembly chaperone | - |
| P3K40_RS03050 (P3K40_02980) | - | 665084..665434 (+) | 351 | WP_096533867.1 | hypothetical protein | - |
| P3K40_RS03055 (P3K40_02985) | - | 665451..668570 (+) | 3120 | WP_110144983.1 | phage tail protein | - |
| P3K40_RS03060 (P3K40_02990) | - | 668583..669515 (+) | 933 | WP_096533865.1 | phage tail family protein | - |
| P3K40_RS03065 (P3K40_02995) | - | 669528..670925 (+) | 1398 | WP_096533864.1 | phage tail protein | - |
| P3K40_RS03070 (P3K40_03000) | - | 670929..671621 (+) | 693 | WP_096533863.1 | hypothetical protein | - |
| P3K40_RS03075 (P3K40_03005) | - | 671633..672676 (+) | 1044 | WP_096533862.1 | SGNH/GDSL hydrolase family protein | - |
| P3K40_RS03080 (P3K40_03010) | - | 672693..673964 (+) | 1272 | WP_404959969.1 | BppU family phage baseplate upper protein | - |
| P3K40_RS03085 (P3K40_03015) | - | 673997..674371 (+) | 375 | WP_015728845.1 | hypothetical protein | - |
| P3K40_RS03090 (P3K40_03020) | - | 674494..676383 (+) | 1890 | WP_270870193.1 | glucosaminidase domain-containing protein | - |
| P3K40_RS03095 (P3K40_03025) | - | 676401..676655 (+) | 255 | WP_015728847.1 | phage holin | - |
| P3K40_RS03100 (P3K40_03030) | - | 676668..677423 (+) | 756 | WP_037543567.1 | CHAP domain-containing protein | - |
| P3K40_RS03105 (P3K40_03035) | - | 677963..678340 (+) | 378 | WP_037542398.1 | YbaN family protein | - |
| P3K40_RS03110 (P3K40_03040) | - | 678609..679532 (+) | 924 | WP_037542400.1 | ABC transporter substrate-binding protein | - |
| P3K40_RS03115 (P3K40_03045) | - | 679973..681499 (-) | 1527 | WP_063284708.1 | sodium:solute symporter | - |
| P3K40_RS03120 (P3K40_03050) | - | 681641..682522 (-) | 882 | WP_063284707.1 | N-acetylneuraminate lyase | - |
| P3K40_RS03125 (P3K40_03055) | - | 682680..683351 (+) | 672 | WP_014613176.1 | FadR/GntR family transcriptional regulator | - |
| P3K40_RS03130 (P3K40_03060) | - | 683332..684195 (+) | 864 | WP_063284705.1 | ROK family protein | - |
| P3K40_RS03135 (P3K40_03065) | - | 684276..684836 (+) | 561 | WP_037542405.1 | biotin transporter BioY | - |
| P3K40_RS03140 (P3K40_03070) | - | 684859..685632 (+) | 774 | WP_096533487.1 | GNAT family N-acetyltransferase | - |
| P3K40_RS03145 (P3K40_03075) | - | 685944..686717 (+) | 774 | WP_096533488.1 | DUF5613 domain-containing protein | - |
| P3K40_RS03150 (P3K40_03080) | fdhD | 686766..687563 (-) | 798 | WP_096533489.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
| P3K40_RS03155 (P3K40_03085) | - | 687722..688756 (+) | 1035 | WP_096533490.1 | LacI family DNA-binding transcriptional regulator | - |
| P3K40_RS03160 (P3K40_03090) | - | 688799..689965 (+) | 1167 | WP_096533491.1 | galactokinase | - |
| P3K40_RS03165 (P3K40_03095) | galE | 689981..690973 (+) | 993 | WP_096533492.1 | UDP-glucose 4-epimerase GalE | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16480.15 Da Isoelectric Point: 4.9225
>NTDB_id=800543 P3K40_RS02860 WP_199612914.1 645828..646265(+) (ssbA) [Staphylococcus pseudintermedius strain CUVET17-667]
MINRVVLIGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
MINRVVLIGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=800543 P3K40_RS02860 WP_199612914.1 645828..646265(+) (ssbA) [Staphylococcus pseudintermedius strain CUVET17-667]
ATGATCAACAGAGTCGTATTGATAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
ATGATCAACAGAGTCGTATTGATAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.655 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.6 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
73.103 |
0.407 |
| ssbA | Streptococcus mutans UA159 |
39.31 |
100 |
0.393 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.621 |
100 |
0.386 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.621 |
100 |
0.386 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.621 |
100 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.931 |
100 |
0.379 |
| ssb | Glaesserella parasuis strain SC1401 |
29.775 |
100 |
0.366 |