Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3K38_RS02845 | Genome accession | NZ_CP119682 |
| Coordinates | 644655..645092 (+) | Length | 145 a.a. |
| NCBI ID | WP_199612914.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET18-1965 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 630491..676970 | 644655..645092 | within | 0 |
Gene organization within MGE regions
Location: 630491..676970
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K38_RS02725 (P3K38_02665) | - | 630491..630967 (+) | 477 | WP_096533482.1 | hypothetical protein | - |
| P3K38_RS02730 (P3K38_02670) | - | 631131..631859 (-) | 729 | WP_015729537.1 | CHAP domain-containing protein | - |
| P3K38_RS02735 (P3K38_02675) | - | 632564..633616 (+) | 1053 | WP_096533483.1 | LLM class flavin-dependent oxidoreductase | - |
| P3K38_RS02740 (P3K38_02680) | - | 633630..633983 (+) | 354 | WP_096533484.1 | DoxX family protein | - |
| P3K38_RS02745 (P3K38_02685) | - | 634446..634793 (+) | 348 | WP_096533485.1 | transcriptional regulator, SarA/Rot family | - |
| P3K38_RS02750 (P3K38_02690) | - | 635232..636383 (+) | 1152 | WP_100004254.1 | acyl-CoA dehydrogenase family protein | - |
| P3K38_RS02755 (P3K38_02695) | - | 636412..637458 (-) | 1047 | WP_063282612.1 | tyrosine-type recombinase/integrase | - |
| P3K38_RS02760 (P3K38_02700) | - | 637522..638310 (-) | 789 | WP_100004255.1 | DUF1828 domain-containing protein | - |
| P3K38_RS02765 (P3K38_02705) | - | 638324..638779 (-) | 456 | WP_100004256.1 | DUF6978 family protein | - |
| P3K38_RS02770 (P3K38_02710) | - | 638827..639336 (-) | 510 | WP_222936263.1 | hypothetical protein | - |
| P3K38_RS02775 (P3K38_02715) | - | 639386..640108 (-) | 723 | WP_081247735.1 | XRE family transcriptional regulator | - |
| P3K38_RS02780 (P3K38_02720) | - | 640260..640472 (+) | 213 | WP_063282614.1 | helix-turn-helix transcriptional regulator | - |
| P3K38_RS02785 (P3K38_02725) | - | 640518..640679 (+) | 162 | WP_037543668.1 | hypothetical protein | - |
| P3K38_RS02790 (P3K38_02730) | - | 640683..640946 (-) | 264 | WP_037543667.1 | CRISPR-associated endonuclease Cas2 | - |
| P3K38_RS02795 (P3K38_02735) | - | 641003..641197 (+) | 195 | WP_015728796.1 | hypothetical protein | - |
| P3K38_RS02800 (P3K38_02740) | - | 641303..641470 (+) | 168 | WP_015728797.1 | hypothetical protein | - |
| P3K38_RS02805 (P3K38_02745) | - | 641467..641694 (-) | 228 | WP_060830240.1 | hypothetical protein | - |
| P3K38_RS02810 (P3K38_02750) | - | 641772..642515 (+) | 744 | WP_060830239.1 | BRO family protein | - |
| P3K38_RS02815 (P3K38_02755) | - | 642512..642736 (+) | 225 | WP_015728800.1 | hypothetical protein | - |
| P3K38_RS02820 (P3K38_02760) | - | 642724..642912 (+) | 189 | WP_065354752.1 | hypothetical protein | - |
| P3K38_RS02825 (P3K38_02765) | - | 642982..643242 (+) | 261 | WP_404959948.1 | DUF1108 family protein | - |
| P3K38_RS02830 (P3K38_02770) | - | 643254..643517 (+) | 264 | WP_404959950.1 | hypothetical protein | - |
| P3K38_RS02835 (P3K38_02775) | - | 643501..643986 (+) | 486 | WP_065354750.1 | siphovirus Gp157 family protein | - |
| P3K38_RS02840 (P3K38_02780) | - | 643987..644655 (+) | 669 | WP_015728804.1 | ERF family protein | - |
| P3K38_RS02845 (P3K38_02785) | ssbA | 644655..645092 (+) | 438 | WP_199612914.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K38_RS02850 (P3K38_02790) | - | 645276..645947 (+) | 672 | WP_110164874.1 | putative HNHc nuclease | - |
| P3K38_RS02855 (P3K38_02795) | - | 645940..646653 (+) | 714 | WP_100002827.1 | helix-turn-helix domain-containing protein | - |
| P3K38_RS02860 (P3K38_02800) | - | 646663..647436 (+) | 774 | WP_100002825.1 | ATP-binding protein | - |
| P3K38_RS02865 (P3K38_02805) | - | 647430..647609 (+) | 180 | WP_096533894.1 | hypothetical protein | - |
| P3K38_RS02870 (P3K38_02810) | - | 647610..648044 (+) | 435 | WP_096533893.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3K38_RS02875 (P3K38_02815) | - | 648028..648246 (+) | 219 | WP_096533892.1 | hypothetical protein | - |
| P3K38_RS02880 (P3K38_02820) | - | 648259..648579 (+) | 321 | WP_096533891.1 | hypothetical protein | - |
| P3K38_RS02885 (P3K38_02825) | - | 648576..648740 (+) | 165 | WP_179292374.1 | hypothetical protein | - |
| P3K38_RS02890 (P3K38_02830) | - | 648740..649192 (+) | 453 | WP_096533890.1 | DUF3310 domain-containing protein | - |
| P3K38_RS02895 (P3K38_02835) | - | 649189..650148 (+) | 960 | WP_096533889.1 | DNA cytosine methyltransferase | - |
| P3K38_RS02900 (P3K38_02840) | - | 650219..650395 (+) | 177 | WP_019169002.1 | hypothetical protein | - |
| P3K38_RS02905 (P3K38_02845) | - | 650395..650781 (+) | 387 | WP_234985437.1 | hypothetical protein | - |
| P3K38_RS02910 (P3K38_02850) | - | 650781..651053 (+) | 273 | WP_404968984.1 | hypothetical protein | - |
| P3K38_RS02915 (P3K38_02855) | - | 651126..651497 (+) | 372 | WP_096533174.1 | hypothetical protein | - |
| P3K38_RS02920 (P3K38_02860) | - | 651516..652046 (+) | 531 | WP_110149713.1 | dUTPase | - |
| P3K38_RS02925 (P3K38_02865) | - | 652119..652547 (+) | 429 | WP_404969008.1 | class I SAM-dependent methyltransferase | - |
| P3K38_RS02930 (P3K38_02870) | - | 652544..652732 (+) | 189 | WP_037542749.1 | DUF1381 domain-containing protein | - |
| P3K38_RS02935 (P3K38_02875) | rinB | 652748..652918 (+) | 171 | WP_096533881.1 | transcriptional activator RinB | - |
| P3K38_RS02940 (P3K38_02880) | - | 652918..653070 (+) | 153 | WP_179292371.1 | hypothetical protein | - |
| P3K38_RS02945 (P3K38_02885) | - | 653073..653492 (+) | 420 | WP_065354588.1 | transcriptional regulator | - |
| P3K38_RS02950 (P3K38_02890) | - | 653691..653918 (+) | 228 | WP_096533880.1 | hypothetical protein | - |
| P3K38_RS02955 (P3K38_02895) | - | 653988..654431 (+) | 444 | WP_096533879.1 | terminase small subunit | - |
| P3K38_RS02960 (P3K38_02900) | - | 654418..655692 (+) | 1275 | WP_404959960.1 | PBSX family phage terminase large subunit | - |
| P3K38_RS02965 (P3K38_02905) | - | 655704..657149 (+) | 1446 | WP_404959962.1 | phage portal protein | - |
| P3K38_RS02970 (P3K38_02910) | - | 657142..658494 (+) | 1353 | WP_110144985.1 | minor capsid protein | - |
| P3K38_RS02975 (P3K38_02915) | - | 658491..658685 (+) | 195 | WP_096533876.1 | LSM domain protein | - |
| P3K38_RS02980 (P3K38_02920) | - | 658837..659445 (+) | 609 | WP_404968936.1 | DUF4355 domain-containing protein | - |
| P3K38_RS02985 (P3K38_02925) | - | 659463..660373 (+) | 911 | Protein_594 | capsid protein | - |
| P3K38_RS02990 (P3K38_02930) | - | 660463..660912 (+) | 450 | WP_096533873.1 | Ig-like domain-containing protein | - |
| P3K38_RS02995 (P3K38_02935) | - | 660924..661256 (+) | 333 | WP_316635251.1 | phage head-tail connector protein | - |
| P3K38_RS03000 (P3K38_02940) | - | 661253..661567 (+) | 315 | WP_060830212.1 | hypothetical protein | - |
| P3K38_RS03005 (P3K38_02945) | - | 661557..661907 (+) | 351 | WP_096533871.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3K38_RS03010 (P3K38_02950) | - | 661919..662314 (+) | 396 | WP_096533870.1 | hypothetical protein | - |
| P3K38_RS03015 (P3K38_02955) | - | 662332..662985 (+) | 654 | WP_096533869.1 | phage major tail protein, TP901-1 family | - |
| P3K38_RS03020 (P3K38_02960) | - | 663045..663425 (+) | 381 | WP_096533868.1 | tail assembly chaperone | - |
| P3K38_RS03025 (P3K38_02965) | - | 663455..663805 (+) | 351 | WP_096533867.1 | hypothetical protein | - |
| P3K38_RS03030 (P3K38_02970) | - | 663822..666941 (+) | 3120 | WP_110144983.1 | phage tail protein | - |
| P3K38_RS03035 (P3K38_02975) | - | 666954..667886 (+) | 933 | WP_096533865.1 | phage tail family protein | - |
| P3K38_RS03040 (P3K38_02980) | - | 667899..669296 (+) | 1398 | WP_096533864.1 | phage tail protein | - |
| P3K38_RS03045 (P3K38_02985) | - | 669300..669992 (+) | 693 | WP_096533863.1 | hypothetical protein | - |
| P3K38_RS03050 (P3K38_02990) | - | 670001..671044 (+) | 1044 | WP_096533862.1 | SGNH/GDSL hydrolase family protein | - |
| P3K38_RS03055 (P3K38_02995) | - | 671061..672332 (+) | 1272 | WP_404968985.1 | BppU family phage baseplate upper protein | - |
| P3K38_RS03060 (P3K38_03000) | - | 672365..672739 (+) | 375 | WP_015728845.1 | hypothetical protein | - |
| P3K38_RS03065 (P3K38_03005) | - | 672862..674751 (+) | 1890 | WP_404968986.1 | glucosaminidase domain-containing protein | - |
| P3K38_RS03070 (P3K38_03010) | - | 674769..675023 (+) | 255 | WP_096536420.1 | phage holin | - |
| P3K38_RS03075 (P3K38_03015) | - | 675036..675791 (+) | 756 | WP_203163221.1 | CHAP domain-containing protein | - |
| P3K38_RS03085 (P3K38_03025) | clpP | 676383..676970 (+) | 588 | WP_014614489.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16480.15 Da Isoelectric Point: 4.9225
>NTDB_id=800314 P3K38_RS02845 WP_199612914.1 644655..645092(+) (ssbA) [Staphylococcus pseudintermedius strain CUVET18-1965]
MINRVVLIGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
MINRVVLIGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=800314 P3K38_RS02845 WP_199612914.1 644655..645092(+) (ssbA) [Staphylococcus pseudintermedius strain CUVET18-1965]
ATGATCAACAGAGTCGTATTGATAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
ATGATCAACAGAGTCGTATTGATAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.655 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.6 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
73.103 |
0.407 |
| ssbA | Streptococcus mutans UA159 |
39.31 |
100 |
0.393 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.621 |
100 |
0.386 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.621 |
100 |
0.386 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.621 |
100 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.931 |
100 |
0.379 |
| ssb | Glaesserella parasuis strain SC1401 |
29.775 |
100 |
0.366 |