Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | P0083_RS10060 | Genome accession | NZ_CP119528 |
| Coordinates | 1974727..1975002 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 3143 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1929543..1974703 | 1974727..1975002 | flank | 24 |
Gene organization within MGE regions
Location: 1929543..1975002
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0083_RS09740 (P0083_09740) | - | 1929543..1930550 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| P0083_RS09745 (P0083_09745) | comGG | 1930679..1931032 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| P0083_RS09750 (P0083_09750) | - | 1931090..1932262 (-) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| P0083_RS09755 (P0083_09755) | comGF | 1932364..1932798 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| P0083_RS09760 (P0083_09760) | - | 1932788..1933159 (-) | 372 | WP_002365830.1 | type II secretion system protein | - |
| P0083_RS09765 (P0083_09765) | - | 1933493..1933618 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| P0083_RS09770 (P0083_09770) | hemH | 1933915..1934856 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| P0083_RS09780 (P0083_09780) | - | 1935596..1935844 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| P0083_RS09785 (P0083_09785) | - | 1935916..1936116 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| P0083_RS09790 (P0083_09790) | - | 1936953..1938194 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| P0083_RS09795 (P0083_09795) | - | 1938195..1938428 (-) | 234 | WP_002384371.1 | phage holin | - |
| P0083_RS09800 (P0083_09800) | - | 1938421..1938642 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| P0083_RS09805 (P0083_09805) | - | 1938677..1938832 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| P0083_RS09810 (P0083_09810) | - | 1938834..1939154 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| P0083_RS09815 (P0083_09815) | - | 1939168..1939659 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| P0083_RS09820 (P0083_09820) | - | 1939659..1939946 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| P0083_RS09825 (P0083_09825) | - | 1939943..1940539 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| P0083_RS09830 (P0083_09830) | - | 1940532..1941413 (-) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| P0083_RS09835 (P0083_09835) | - | 1941432..1944239 (-) | 2808 | WP_002387289.1 | phage tail spike protein | - |
| P0083_RS09840 (P0083_09840) | - | 1944221..1944955 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| P0083_RS09845 (P0083_09845) | - | 1944945..1947842 (-) | 2898 | WP_276131437.1 | tape measure protein | - |
| P0083_RS09850 (P0083_09850) | - | 1948090..1948440 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| P0083_RS09855 (P0083_09855) | - | 1948493..1949341 (-) | 849 | WP_002387287.1 | major tail protein | - |
| P0083_RS09860 (P0083_09860) | - | 1949342..1949716 (-) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| P0083_RS09865 (P0083_09865) | - | 1949719..1950117 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| P0083_RS09870 (P0083_09870) | - | 1950110..1950484 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| P0083_RS09875 (P0083_09875) | - | 1950481..1950825 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| P0083_RS09880 (P0083_09880) | - | 1950839..1951021 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| P0083_RS09885 (P0083_09885) | - | 1951050..1951937 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| P0083_RS09890 (P0083_09890) | - | 1951951..1952574 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| P0083_RS09895 (P0083_09895) | - | 1952743..1953063 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| P0083_RS09900 (P0083_09900) | - | 1953120..1953350 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| P0083_RS09905 (P0083_09905) | - | 1953351..1955255 (-) | 1905 | WP_010706494.1 | head protein | - |
| P0083_RS09910 (P0083_09910) | - | 1955230..1956702 (-) | 1473 | WP_010706495.1 | phage portal protein | - |
| P0083_RS09915 (P0083_09915) | terL | 1956714..1958102 (-) | 1389 | WP_002387276.1 | phage terminase large subunit | - |
| P0083_RS09920 (P0083_09920) | - | 1958095..1958556 (-) | 462 | WP_002383816.1 | helix-turn-helix domain-containing protein | - |
| P0083_RS09925 (P0083_09925) | - | 1958632..1958808 (-) | 177 | WP_010706496.1 | hypothetical protein | - |
| P0083_RS09930 (P0083_09930) | - | 1958992..1959804 (-) | 813 | WP_002387275.1 | hypothetical protein | - |
| P0083_RS09935 (P0083_09935) | - | 1959916..1960149 (-) | 234 | Protein_1929 | hypothetical protein | - |
| P0083_RS09940 (P0083_09940) | - | 1960733..1961203 (-) | 471 | WP_002383811.1 | hypothetical protein | - |
| P0083_RS09945 (P0083_09945) | - | 1961228..1962151 (-) | 924 | WP_002383810.1 | DUF6731 family protein | - |
| P0083_RS09955 (P0083_09955) | - | 1962869..1963285 (-) | 417 | WP_010706497.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| P0083_RS09960 (P0083_09960) | - | 1964193..1964600 (-) | 408 | WP_025191675.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P0083_RS09965 (P0083_09965) | - | 1964597..1965112 (-) | 516 | Protein_1934 | helix-turn-helix domain-containing protein | - |
| P0083_RS09970 (P0083_09970) | - | 1965214..1966386 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| P0083_RS09975 (P0083_09975) | - | 1966439..1966786 (-) | 348 | Protein_1936 | helix-turn-helix domain-containing protein | - |
| P0083_RS09980 (P0083_09980) | - | 1966786..1966986 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| P0083_RS09985 (P0083_09985) | - | 1966991..1967374 (-) | 384 | WP_002383802.1 | putative HNHc nuclease | - |
| P0083_RS09990 (P0083_09990) | - | 1967413..1967631 (-) | 219 | WP_002383801.1 | hypothetical protein | - |
| P0083_RS09995 (P0083_09995) | - | 1967636..1968370 (-) | 735 | WP_002383799.1 | ERF family protein | - |
| P0083_RS10000 (P0083_10000) | - | 1968363..1968680 (-) | 318 | WP_002383798.1 | hypothetical protein | - |
| P0083_RS10005 (P0083_10005) | - | 1968876..1969214 (-) | 339 | WP_002383796.1 | hypothetical protein | - |
| P0083_RS10010 (P0083_10010) | - | 1969251..1969460 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| P0083_RS10015 (P0083_10015) | - | 1969515..1969703 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| P0083_RS10020 (P0083_10020) | - | 1969729..1970451 (-) | 723 | WP_002387270.1 | phage regulatory protein | - |
| P0083_RS10025 (P0083_10025) | - | 1970474..1970785 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| P0083_RS10030 (P0083_10030) | - | 1970797..1970988 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| P0083_RS10035 (P0083_10035) | - | 1971284..1971625 (+) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| P0083_RS10040 (P0083_10040) | - | 1971630..1972280 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P0083_RS10045 (P0083_10045) | - | 1972376..1973005 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| P0083_RS10050 (P0083_10050) | - | 1973111..1974259 (+) | 1149 | WP_002387264.1 | site-specific integrase | - |
| P0083_RS10055 (P0083_10055) | comGD | 1974296..1974730 (-) | 435 | Protein_1952 | competence type IV pilus minor pilin ComGD | - |
| P0083_RS10060 (P0083_10060) | comGC/cglC | 1974727..1975002 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=799527 P0083_RS10060 WP_002356991.1 1974727..1975002(-) (comGC/cglC) [Enterococcus faecalis strain 3143]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=799527 P0083_RS10060 WP_002356991.1 1974727..1975002(-) (comGC/cglC) [Enterococcus faecalis strain 3143]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |