Detailed information NTG0795536

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYH74_RS06150
• Genome accession: NZ_CP118814
• Coordinates: 1281410..1281727 (+)
• Length: 105 a.a.
• NCBI ID: WP_001831271.1
• Uniprot ID: A0A9Q5JKE9
• Organism: Staphylococcus epidermidis strain 7060
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1276410..1286727

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYH74_RS06125 (PYH74_06125)	-	1276835..1277131 (+)	297	WP_002311824.1	hypothetical protein	-
PYH74_RS06130 (PYH74_06130)	-	1277138..1279090 (+)	1953	WP_000163792.1	hypothetical protein	-
PYH74_RS06135 (PYH74_06135)	dfrG	1279162..1279659 (-)	498	WP_000868795.1	trimethoprim-resistant dihydrofolate reductase DfrG	-
PYH74_RS06140 (PYH74_06140)	-	1279934..1280353 (+)	420	Protein_1169	ATPase, T2SS/T4P/T4SS family	-
PYH74_RS06145 (PYH74_06145)	comGB	1280325..1281392 (+)	1068	WP_001831131.1	competence type IV pilus assembly protein ComGB	Machinery gene
PYH74_RS06150 (PYH74_06150)	comGC	1281410..1281727 (+)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
PYH74_RS06155 (PYH74_06155)	comGD	1281717..1282154 (+)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
PYH74_RS06160 (PYH74_06160)	-	1282141..1282434 (+)	294	WP_001831116.1	hypothetical protein	-
PYH74_RS06165 (PYH74_06165)	-	1282358..1282879 (+)	522	WP_282888210.1	competence type IV pilus minor pilin ComGF	-
PYH74_RS06170 (PYH74_06170)	-	1283015..1283527 (+)	513	WP_002440040.1	shikimate kinase	-
PYH74_RS06175 (PYH74_06175)	gcvT	1283745..1284836 (+)	1092	WP_001831107.1	glycine cleavage system aminomethyltransferase GcvT	-
PYH74_RS06180 (PYH74_06180)	gcvPA	1284856..1286202 (+)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=795536 PYH74_RS06150 WP_001831271.1 1281410..1281727(+) (comGC) [Staphylococcus epidermidis strain 7060]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=795536 PYH74_RS06150 WP_001831271.1 1281410..1281727(+) (comGC) [Staphylococcus epidermidis strain 7060]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362