Detailed information NTG0795462

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYH57_RS08125
• Genome accession: NZ_CP118810
• Coordinates: 1655325..1655636 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 7062
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1650325..1660636

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYH57_RS08090 (PYH57_08080)	gcvPA	1650828..1652174 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
PYH57_RS08095 (PYH57_08085)	gcvT	1652194..1653285 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
PYH57_RS08100 (PYH57_08090)	-	1653444..1653968 (-)	525	WP_353458906.1	shikimate kinase	-
PYH57_RS08105 (PYH57_08095)	-	1653958..1654104 (-)	147	WP_001789879.1	hypothetical protein	-
PYH57_RS08110 (PYH57_08100)	comGF	1654201..1654698 (-)	498	WP_029656266.1	competence type IV pilus minor pilin ComGF	Machinery gene
PYH57_RS08115 (PYH57_08105)	comGE	1654616..1654915 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
PYH57_RS08120 (PYH57_08110)	comGD	1654902..1655347 (-)	446	Protein_1595	competence type IV pilus minor pilin ComGD	-
PYH57_RS08125 (PYH57_08115)	comGC	1655325..1655636 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
PYH57_RS08130 (PYH57_08120)	comGB	1655650..1656720 (-)	1071	WP_000776417.1	competence type IV pilus assembly protein ComGB	Machinery gene
PYH57_RS08135 (PYH57_08125)	comGA	1656692..1657666 (-)	975	WP_250426016.1	competence type IV pilus ATPase ComGA	Machinery gene
PYH57_RS08140 (PYH57_08130)	-	1657718..1658341 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
PYH57_RS08145 (PYH57_08135)	-	1658338..1658667 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
PYH57_RS08150 (PYH57_08140)	-	1658667..1659653 (-)	987	WP_000161315.1	ROK family glucokinase	-
PYH57_RS08155 (PYH57_08145)	-	1659650..1659853 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=795462 PYH57_RS08125 WP_000472256.1 1655325..1655636(-) (comGC) [Staphylococcus aureus strain 7062]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=795462 PYH57_RS08125 WP_000472256.1 1655325..1655636(-) (comGC) [Staphylococcus aureus strain 7062]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369