NTDB

Overview

Name	comGC/cglC	Type	Machinery gene
Locus tag	PUW74_RS01150	Genome accession	NZ_CP118080
Coordinates	199703..200032 (+)	Length	109 a.a.
NCBI ID	WP_000793380.1	Uniprot ID	A0A0E1EKJ1
Organism	Streptococcus agalactiae strain VSI14
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 194703..205032

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW74_RS01135 (PUW74_01135)	-	197260..197625 (+)	366	WP_000285373.1	DUF1033 family protein	-
PUW74_RS01140 (PUW74_01140)	comYA	197798..198769 (+)	972	WP_000250805.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW74_RS01145 (PUW74_01145)	comYB	198663..199706 (+)	1044	WP_223295889.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW74_RS01150 (PUW74_01150)	comGC/cglC	199703..200032 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW74_RS01155 (PUW74_01155)	comYD	200007..200420 (+)	414	WP_000244261.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW74_RS01160 (PUW74_01160)	comGE	200392..200691 (+)	300	WP_000234804.1	competence type IV pilus minor pilin ComGE	-
PUW74_RS01165 (PUW74_01165)	comGF	200645..201106 (+)	462	WP_001874812.1	competence type IV pilus minor pilin ComGF	-
PUW74_RS01170 (PUW74_01170)	comGG	201084..201455 (+)	372	WP_000601104.1	competence type IV pilus minor pilin ComGG	-
PUW74_RS01175 (PUW74_01175)	comYH	201570..202544 (+)	975	WP_001008574.1	N-6 DNA methylase	Machinery gene
PUW74_RS01180 (PUW74_01180)	-	202576..203769 (+)	1194	WP_000047534.1	acetate kinase	-
PUW74_RS01185 (PUW74_01185)	-	203921..204127 (+)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
PUW74_RS01190 (PUW74_01190)	-	204195..204323 (+)	129	WP_014959723.1	hypothetical protein	-
PUW74_RS01195 (PUW74_01195)	-	204364..204819 (+)	456	WP_000905673.1	hypothetical protein	-

Sequence

Protein

Download Length: 109 a.a. Molecular weight: 12129.27 Da Isoelectric Point: 10.0311

                                >NTDB_id=789934 PUW74_RS01150 WP_000793380.1 199703..200032(+) (comGC/cglC) [Streptococcus agalactiae strain VSI14]

MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK

SGGYITEKQEKAYLDYYKDSSNGSQKISS

Nucleotide

Download Length: 330 bp

                                >NTDB_id=789934 PUW74_RS01150 WP_000793380.1 199703..200032(+) (comGC/cglC) [Streptococcus agalactiae strain VSI14]

ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT

TATTTCGGTCTTGTTGTTATTGTTTGTACCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCCGCTG

TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA

TCTGGAGGATATATTACTGAAAAGCAAGAAAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT

TTCAAGTTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0E1EKJ1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC/cglC	Streptococcus mitis NCTC 12261	60.55	100	0.606
comGC/cglC	Streptococcus mitis SK321	59.633	100	0.596
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	94.495	0.578
comGC/cglC	Streptococcus pneumoniae TIGR4	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae R6	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae Rx1	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae D39	57.798	100	0.578
comYC	Streptococcus mutans UA159	55.238	96.33	0.532
comYC	Streptococcus mutans UA140	55.238	96.33	0.532
comGC	Lactococcus lactis subsp. cremoris KW2	63.043	84.404	0.532
comYC	Streptococcus suis isolate S10	65.854	75.229	0.495

Detailed information NTG0789934