Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | PT722_RS05435 | Genome accession | NZ_CP117970 |
| Coordinates | 1189996..1190271 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain B-537 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1190295..1229526 | 1189996..1190271 | flank | 24 |
Gene organization within MGE regions
Location: 1189996..1229526
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT722_RS05435 | comGC/cglC | 1189996..1190271 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PT722_RS05440 | comGD | 1190268..1190711 (+) | 444 | WP_137007137.1 | competence type IV pilus minor pilin ComGD | - |
| PT722_RS05445 | - | 1190739..1191887 (-) | 1149 | WP_002364359.1 | tyrosine-type recombinase/integrase | - |
| PT722_RS05450 | - | 1191984..1192712 (-) | 729 | WP_002364358.1 | ion transporter | - |
| PT722_RS05455 | - | 1192746..1192820 (-) | 75 | Protein_1073 | ImmA/IrrE family metallo-endopeptidase | - |
| PT722_RS05460 | - | 1192880..1193785 (-) | 906 | WP_016630909.1 | DUF4352 domain-containing protein | - |
| PT722_RS05465 | - | 1193879..1194223 (-) | 345 | WP_002364356.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PT722_RS05470 | - | 1194240..1194572 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| PT722_RS05475 | - | 1194884..1195060 (+) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| PT722_RS05480 | - | 1195071..1195369 (+) | 299 | Protein_1078 | hypothetical protein | - |
| PT722_RS05485 | - | 1195408..1196133 (+) | 726 | WP_002364352.1 | Rha family transcriptional regulator | - |
| PT722_RS05490 | - | 1196159..1196347 (-) | 189 | WP_002364350.1 | YegP family protein | - |
| PT722_RS05495 | - | 1196402..1196611 (+) | 210 | WP_002399426.1 | hypothetical protein | - |
| PT722_RS05500 | - | 1196648..1196986 (+) | 339 | WP_002364347.1 | hypothetical protein | - |
| PT722_RS05505 | - | 1197271..1197825 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| PT722_RS05510 | - | 1198045..1198362 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| PT722_RS05515 | - | 1198355..1199089 (+) | 735 | WP_002364345.1 | ERF family protein | - |
| PT722_RS05520 | - | 1199094..1199735 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| PT722_RS05525 | - | 1199740..1199940 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| PT722_RS05530 | - | 1199940..1200797 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| PT722_RS05535 | - | 1200794..1201222 (+) | 429 | WP_002364342.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PT722_RS05540 | - | 1202130..1202546 (+) | 417 | WP_002364339.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PT722_RS05550 | - | 1203077..1203691 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| PT722_RS05555 | - | 1204227..1204457 (+) | 231 | WP_002364294.1 | hypothetical protein | - |
| PT722_RS05560 | - | 1204489..1204923 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| PT722_RS05565 | - | 1204904..1206187 (+) | 1284 | WP_002364296.1 | PBSX family phage terminase large subunit | - |
| PT722_RS05570 | - | 1206187..1207671 (+) | 1485 | WP_002364297.1 | phage portal protein | - |
| PT722_RS05575 | - | 1207664..1208590 (+) | 927 | WP_002364298.1 | minor capsid protein | - |
| PT722_RS05580 | - | 1208713..1209348 (+) | 636 | WP_010730822.1 | DUF4355 domain-containing protein | - |
| PT722_RS05585 | - | 1209361..1210257 (+) | 897 | WP_002363368.1 | hypothetical protein | - |
| PT722_RS05590 | - | 1210328..1210660 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| PT722_RS05595 | - | 1210657..1210932 (+) | 276 | WP_002364301.1 | hypothetical protein | - |
| PT722_RS05600 | - | 1210929..1211267 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PT722_RS05605 | gp17 | 1211264..1211656 (+) | 393 | WP_002363373.1 | tail completion protein gp17 | - |
| PT722_RS05610 | - | 1211675..1212280 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| PT722_RS05615 | - | 1212283..1212591 (+) | 309 | WP_002364303.1 | hypothetical protein | - |
| PT722_RS05620 | - | 1212654..1213052 (+) | 399 | WP_002364304.1 | tail assembly chaperone | - |
| PT722_RS05625 | - | 1213121..1213426 (+) | 306 | WP_002364305.1 | hypothetical protein | - |
| PT722_RS05630 | - | 1213413..1217867 (+) | 4455 | WP_002399422.1 | phage tail tape measure protein | - |
| PT722_RS05635 | - | 1217864..1218586 (+) | 723 | WP_002399421.1 | hypothetical protein | - |
| PT722_RS05640 | - | 1218586..1220031 (+) | 1446 | WP_002399420.1 | phage tail spike protein | - |
| PT722_RS05645 | - | 1220037..1220777 (+) | 741 | WP_002399419.1 | hypothetical protein | - |
| PT722_RS05650 | - | 1220794..1221246 (+) | 453 | WP_002399418.1 | hypothetical protein | - |
| PT722_RS05655 | - | 1221265..1221660 (+) | 396 | WP_002399417.1 | hypothetical protein | - |
| PT722_RS05660 | - | 1221662..1221784 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| PT722_RS05665 | - | 1221795..1222175 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| PT722_RS05670 | - | 1222188..1223447 (+) | 1260 | WP_002365833.1 | LysM peptidoglycan-binding domain-containing protein | - |
| PT722_RS05675 | - | 1224283..1224483 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| PT722_RS05680 | - | 1224555..1224806 (+) | 252 | WP_002365832.1 | hypothetical protein | - |
| PT722_RS05690 | hemH | 1225549..1226490 (+) | 942 | WP_002365831.1 | ferrochelatase | - |
| PT722_RS05695 | - | 1227242..1227613 (+) | 372 | WP_002365830.1 | type II secretion system protein | - |
| PT722_RS05700 | comGF | 1227603..1228037 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| PT722_RS05705 | comGG | 1228037..1228390 (+) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| PT722_RS05710 | - | 1228519..1229526 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=788660 PT722_RS05435 WP_002356991.1 1189996..1190271(+) (comGC/cglC) [Enterococcus faecalis strain B-537]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=788660 PT722_RS05435 WP_002356991.1 1189996..1190271(+) (comGC/cglC) [Enterococcus faecalis strain B-537]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATTGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATTGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |