Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | PSC76_RS08730 | Genome accession | NZ_CP117496 |
| Coordinates | 1761162..1761437 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain CQHZJ21-185 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1725188..1779543 | 1761162..1761437 | within | 0 |
Gene organization within MGE regions
Location: 1725188..1779543
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC76_RS08490 (PSC76_08485) | - | 1725188..1726195 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| PSC76_RS08495 (PSC76_08490) | comGG | 1726324..1726677 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| PSC76_RS08500 (PSC76_08495) | comGF | 1726677..1727111 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| PSC76_RS08505 (PSC76_08500) | - | 1727101..1727427 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| PSC76_RS08510 (PSC76_08505) | - | 1727617..1728987 (-) | 1371 | WP_033779878.1 | DUF6056 family protein | - |
| PSC76_RS08515 (PSC76_08510) | - | 1729150..1730253 (-) | 1104 | WP_002395768.1 | SH3 domain-containing protein | - |
| PSC76_RS08520 (PSC76_08515) | - | 1730295..1730501 (-) | 207 | WP_002395769.1 | BhlA/UviB family holin-like peptide | - |
| PSC76_RS08525 (PSC76_08520) | - | 1730510..1730632 (-) | 123 | WP_002395770.1 | XkdX family protein | - |
| PSC76_RS08530 (PSC76_08525) | - | 1730632..1731006 (-) | 375 | WP_338468810.1 | hypothetical protein | - |
| PSC76_RS08535 (PSC76_08530) | - | 1731021..1731572 (-) | 552 | WP_338468811.1 | hypothetical protein | - |
| PSC76_RS08540 (PSC76_08535) | - | 1731572..1731859 (-) | 288 | WP_002365086.1 | collagen-like protein | - |
| PSC76_RS08545 (PSC76_08540) | - | 1731856..1732452 (-) | 597 | WP_002365087.1 | hypothetical protein | - |
| PSC76_RS08550 (PSC76_08545) | - | 1732445..1733326 (-) | 882 | WP_338468812.1 | phage baseplate upper protein | - |
| PSC76_RS08555 (PSC76_08550) | - | 1733345..1736140 (-) | 2796 | WP_338468813.1 | phage tail tip lysozyme | - |
| PSC76_RS08560 (PSC76_08555) | - | 1736137..1736850 (-) | 714 | WP_338468814.1 | phage tail protein | - |
| PSC76_RS08565 (PSC76_08560) | - | 1736847..1739150 (-) | 2304 | WP_338468815.1 | phage tail tape measure protein | - |
| PSC76_RS08570 (PSC76_08565) | - | 1739342..1739797 (-) | 456 | WP_002373982.1 | hypothetical protein | - |
| PSC76_RS08575 (PSC76_08570) | - | 1739797..1740444 (-) | 648 | WP_231433059.1 | major tail protein | - |
| PSC76_RS08580 (PSC76_08575) | - | 1740441..1740803 (-) | 363 | WP_104858198.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PSC76_RS08585 (PSC76_08580) | - | 1740793..1741131 (-) | 339 | WP_016617774.1 | hypothetical protein | - |
| PSC76_RS08590 (PSC76_08585) | - | 1741121..1741447 (-) | 327 | WP_002373974.1 | phage head closure protein | - |
| PSC76_RS08595 (PSC76_08590) | - | 1741425..1741706 (-) | 282 | WP_002395304.1 | phage gp6-like head-tail connector protein | - |
| PSC76_RS08600 (PSC76_08595) | - | 1741709..1743070 (-) | 1362 | WP_105194770.1 | phage major capsid protein | - |
| PSC76_RS08605 (PSC76_08600) | - | 1743083..1743655 (-) | 573 | WP_002393031.1 | HK97 family phage prohead protease | - |
| PSC76_RS08610 (PSC76_08605) | - | 1743642..1744853 (-) | 1212 | WP_029736326.1 | phage portal protein | - |
| PSC76_RS08615 (PSC76_08610) | - | 1744872..1746599 (-) | 1728 | WP_105194769.1 | terminase TerL endonuclease subunit | - |
| PSC76_RS08620 (PSC76_08615) | - | 1746596..1747048 (-) | 453 | WP_064687382.1 | P27 family phage terminase small subunit | - |
| PSC76_RS08625 (PSC76_08620) | - | 1747161..1747529 (-) | 369 | WP_002393035.1 | HNH endonuclease signature motif containing protein | - |
| PSC76_RS08630 (PSC76_08625) | - | 1747529..1747909 (-) | 381 | WP_338468816.1 | Rho termination factor N-terminal domain-containing protein | - |
| PSC76_RS08635 (PSC76_08630) | - | 1748041..1748457 (-) | 417 | WP_010826705.1 | sigma-70 family RNA polymerase sigma factor | - |
| PSC76_RS08640 (PSC76_08635) | - | 1748763..1750616 (-) | 1854 | WP_338468817.1 | phage/plasmid primase, P4 family | - |
| PSC76_RS08645 (PSC76_08640) | - | 1750684..1750914 (+) | 231 | WP_338468818.1 | hypothetical protein | - |
| PSC76_RS08650 (PSC76_08645) | - | 1750911..1752473 (-) | 1563 | WP_338468819.1 | hypothetical protein | - |
| PSC76_RS08655 (PSC76_08650) | - | 1752496..1753008 (-) | 513 | WP_016626786.1 | hypothetical protein | - |
| PSC76_RS08660 (PSC76_08655) | - | 1753059..1753979 (-) | 921 | WP_338468820.1 | AAA family ATPase | - |
| PSC76_RS08665 (PSC76_08660) | - | 1753976..1754194 (-) | 219 | WP_016634639.1 | hypothetical protein | - |
| PSC76_RS08670 (PSC76_08665) | - | 1754196..1755107 (-) | 912 | WP_338468821.1 | YqaJ viral recombinase family protein | - |
| PSC76_RS08675 (PSC76_08670) | - | 1755120..1755362 (-) | 243 | WP_010826713.1 | hypothetical protein | - |
| PSC76_RS08680 (PSC76_08675) | - | 1755364..1756560 (-) | 1197 | WP_338468893.1 | DEAD/DEAH box helicase | - |
| PSC76_RS08685 (PSC76_08680) | - | 1756550..1756843 (-) | 294 | WP_338468822.1 | VRR-NUC domain-containing protein | - |
| PSC76_RS08690 (PSC76_08685) | - | 1756840..1757040 (-) | 201 | WP_338468823.1 | hypothetical protein | - |
| PSC76_RS08695 (PSC76_08690) | - | 1757259..1757705 (-) | 447 | WP_338468824.1 | hypothetical protein | - |
| PSC76_RS08700 (PSC76_08695) | - | 1757948..1758259 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| PSC76_RS08705 (PSC76_08700) | - | 1758270..1758446 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| PSC76_RS08710 (PSC76_08705) | - | 1758757..1759080 (+) | 324 | WP_338468825.1 | helix-turn-helix transcriptional regulator | - |
| PSC76_RS08715 (PSC76_08710) | - | 1759098..1759442 (+) | 345 | WP_338468826.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PSC76_RS08720 (PSC76_08715) | - | 1759546..1760694 (+) | 1149 | WP_002387264.1 | site-specific integrase | - |
| PSC76_RS08725 (PSC76_08720) | comGD | 1760731..1761165 (-) | 435 | Protein_1687 | competence type IV pilus minor pilin ComGD | - |
| PSC76_RS08730 (PSC76_08725) | comGC/cglC | 1761162..1761437 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PSC76_RS08735 (PSC76_08730) | comGB | 1761437..1762483 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| PSC76_RS08740 (PSC76_08735) | comGA | 1762440..1763408 (-) | 969 | WP_010717651.1 | competence type IV pilus ATPase ComGA | - |
| PSC76_RS08745 (PSC76_08740) | - | 1763648..1764976 (-) | 1329 | WP_002362058.1 | amino acid permease | - |
| PSC76_RS08750 (PSC76_08745) | rlmN | 1765266..1766339 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| PSC76_RS08755 (PSC76_08750) | - | 1766465..1768294 (-) | 1830 | WP_010717652.1 | ABC transporter permease | - |
| PSC76_RS08760 (PSC76_08755) | - | 1768284..1769033 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| PSC76_RS08765 (PSC76_08760) | - | 1769151..1769852 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| PSC76_RS08770 (PSC76_08765) | - | 1769983..1772406 (-) | 2424 | WP_002380448.1 | DNA translocase FtsK | - |
| PSC76_RS08775 (PSC76_08770) | - | 1772720..1773931 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PSC76_RS08780 (PSC76_08775) | - | 1773960..1774865 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| PSC76_RS08785 (PSC76_08780) | - | 1774987..1775967 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| PSC76_RS08790 (PSC76_08785) | cydC | 1776047..1777813 (-) | 1767 | WP_002364368.1 | thiol reductant ABC exporter subunit CydC | - |
| PSC76_RS08795 (PSC76_08790) | cydD | 1777810..1779543 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=786039 PSC76_RS08730 WP_002356991.1 1761162..1761437(-) (comGC/cglC) [Enterococcus faecalis strain CQHZJ21-185]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=786039 PSC76_RS08730 WP_002356991.1 1761162..1761437(-) (comGC/cglC) [Enterococcus faecalis strain CQHZJ21-185]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |