Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | M0P28_RS00875 | Genome accession | NZ_CP116958 |
| Coordinates | 129199..129594 (+) | Length | 131 a.a. |
| NCBI ID | WP_013851404.1 | Uniprot ID | A0AAW6YLG6 |
| Organism | Streptococcus pasteurianus strain WUSP074 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 85917..138325 | 129199..129594 | within | 0 |
Gene organization within MGE regions
Location: 85917..138325
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0P28_RS00650 (M0P28_00650) | - | 86290..87426 (-) | 1137 | WP_117480059.1 | tyrosine-type recombinase/integrase | - |
| M0P28_RS00655 (M0P28_00655) | - | 87437..87619 (-) | 183 | WP_117480061.1 | DUF3173 family protein | - |
| M0P28_RS00660 (M0P28_00660) | - | 87713..89020 (-) | 1308 | WP_117480063.1 | Rep family protein | - |
| M0P28_RS00665 (M0P28_00665) | - | 89340..89705 (-) | 366 | WP_117480065.1 | hypothetical protein | - |
| M0P28_RS00670 (M0P28_00670) | - | 89717..90175 (-) | 459 | WP_117480067.1 | hypothetical protein | - |
| M0P28_RS00675 (M0P28_00675) | - | 90315..90950 (+) | 636 | WP_117480069.1 | helix-turn-helix domain-containing protein | - |
| M0P28_RS00680 (M0P28_00680) | - | 91360..92313 (+) | 954 | WP_003067143.1 | IS30 family transposase | - |
| M0P28_RS00685 (M0P28_00685) | - | 92523..92816 (+) | 294 | WP_117480071.1 | hypothetical protein | - |
| M0P28_RS00690 (M0P28_00690) | - | 92797..93276 (+) | 480 | WP_117480074.1 | NADPH-dependent FMN reductase | - |
| M0P28_RS00695 (M0P28_00695) | - | 93263..94372 (+) | 1110 | WP_248488384.1 | CocE/NonD family hydrolase | - |
| M0P28_RS00700 (M0P28_00700) | - | 94362..95588 (+) | 1227 | WP_117480078.1 | YcaO-like family protein | - |
| M0P28_RS00705 (M0P28_00705) | - | 95599..96144 (+) | 546 | WP_117480080.1 | class I SAM-dependent methyltransferase | - |
| M0P28_RS00710 (M0P28_00710) | - | 96430..97575 (+) | 1146 | WP_041973040.1 | IS110 family transposase | - |
| M0P28_RS00715 (M0P28_00715) | - | 97702..98829 (+) | 1128 | WP_274513095.1 | MFS transporter | - |
| M0P28_RS00720 (M0P28_00720) | - | 98826..99650 (+) | 825 | WP_117480084.1 | hypothetical protein | - |
| M0P28_RS00725 (M0P28_00725) | - | 99697..100245 (+) | 549 | WP_117480086.1 | GNAT family N-acetyltransferase | - |
| M0P28_RS12110 | - | 100592..100781 (+) | 190 | Protein_94 | IS30 family transposase | - |
| M0P28_RS00735 (M0P28_00735) | ispE | 102370..103218 (+) | 849 | WP_003062897.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| M0P28_RS00740 (M0P28_00740) | - | 103294..103740 (+) | 447 | WP_003062900.1 | zinc-dependent MarR family transcriptional regulator | - |
| M0P28_RS00745 (M0P28_00745) | - | 103737..104447 (+) | 711 | WP_117479476.1 | metal ABC transporter ATP-binding protein | - |
| M0P28_RS00750 (M0P28_00750) | - | 104437..105255 (+) | 819 | WP_003062905.1 | metal ABC transporter permease | - |
| M0P28_RS00755 (M0P28_00755) | tyrS | 105330..106586 (-) | 1257 | WP_058692626.1 | tyrosine--tRNA ligase | - |
| M0P28_RS00760 (M0P28_00760) | pbp1b | 106746..109070 (+) | 2325 | WP_117479474.1 | penicillin-binding protein PBP1B | - |
| M0P28_RS00765 (M0P28_00765) | rpoB | 109413..112985 (+) | 3573 | WP_003062912.1 | DNA-directed RNA polymerase subunit beta | - |
| M0P28_RS00770 (M0P28_00770) | rpoC | 113162..116800 (+) | 3639 | WP_003062914.1 | DNA-directed RNA polymerase subunit beta' | - |
| M0P28_RS00775 (M0P28_00775) | - | 116966..117328 (+) | 363 | WP_058692629.1 | DUF1033 family protein | - |
| M0P28_RS00780 (M0P28_00780) | comYA | 117399..118340 (+) | 942 | WP_003062917.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| M0P28_RS00785 (M0P28_00785) | comYB | 118264..119307 (+) | 1044 | WP_003062919.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| M0P28_RS00790 (M0P28_00790) | comYC | 119307..119600 (+) | 294 | WP_117479472.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| M0P28_RS00795 (M0P28_00795) | comYD | 119584..120015 (+) | 432 | WP_058692630.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| M0P28_RS00800 (M0P28_00800) | comGE | 119969..120262 (+) | 294 | WP_081048608.1 | competence type IV pilus minor pilin ComGE | - |
| M0P28_RS00805 (M0P28_00805) | comYF | 120216..120683 (+) | 468 | WP_058692632.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| M0P28_RS00810 (M0P28_00810) | comYG | 120637..120987 (+) | 351 | WP_238374707.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| M0P28_RS00815 (M0P28_00815) | comYH | 121042..122013 (+) | 972 | WP_117479470.1 | class I SAM-dependent methyltransferase | Machinery gene |
| M0P28_RS00820 (M0P28_00820) | - | 122051..123250 (+) | 1200 | WP_058692635.1 | acetate kinase | - |
| M0P28_RS00825 (M0P28_00825) | - | 123417..123617 (+) | 201 | WP_058692636.1 | helix-turn-helix transcriptional regulator | - |
| M0P28_RS00830 (M0P28_00830) | - | 123627..123833 (+) | 207 | WP_058692637.1 | hypothetical protein | - |
| M0P28_RS00835 (M0P28_00835) | - | 123824..124276 (+) | 453 | WP_117479468.1 | ABC transporter permease | - |
| M0P28_RS00840 (M0P28_00840) | - | 124288..124923 (+) | 636 | WP_058692639.1 | CPBP family intramembrane glutamic endopeptidase | - |
| M0P28_RS00845 (M0P28_00845) | proC | 124967..125737 (-) | 771 | WP_058692640.1 | pyrroline-5-carboxylate reductase | - |
| M0P28_RS00850 (M0P28_00850) | pepA | 125798..126865 (-) | 1068 | WP_058692641.1 | glutamyl aminopeptidase | - |
| M0P28_RS00855 (M0P28_00855) | - | 126908..127417 (-) | 510 | WP_058692642.1 | GNAT family N-acetyltransferase | - |
| M0P28_RS00860 (M0P28_00860) | - | 127866..128159 (+) | 294 | WP_041974068.1 | DUF4651 domain-containing protein | - |
| M0P28_RS00865 (M0P28_00865) | - | 128152..128469 (+) | 318 | WP_009853246.1 | thioredoxin family protein | - |
| M0P28_RS00870 (M0P28_00870) | ytpR | 128478..129104 (+) | 627 | WP_117479466.1 | YtpR family tRNA-binding protein | - |
| M0P28_RS00875 (M0P28_00875) | ssbA | 129199..129594 (+) | 396 | WP_013851404.1 | single-stranded DNA-binding protein | Machinery gene |
| M0P28_RS00880 (M0P28_00880) | - | 129713..130519 (+) | 807 | WP_058692643.1 | Cof-type HAD-IIB family hydrolase | - |
| M0P28_RS00885 (M0P28_00885) | - | 130673..131638 (+) | 966 | WP_013851405.1 | sugar ABC transporter substrate-binding protein | - |
| M0P28_RS00890 (M0P28_00890) | - | 131629..132954 (+) | 1326 | WP_370695861.1 | sensor histidine kinase | - |
| M0P28_RS00895 (M0P28_00895) | - | 132951..133634 (+) | 684 | WP_003062946.1 | response regulator transcription factor | - |
| M0P28_RS00900 (M0P28_00900) | - | 133627..134931 (+) | 1305 | WP_117479463.1 | ABC transporter substrate-binding protein | - |
| M0P28_RS00905 (M0P28_00905) | - | 135097..135525 (+) | 429 | WP_117479461.1 | PTS sugar transporter subunit IIA | - |
| M0P28_RS00910 (M0P28_00910) | - | 135541..136035 (+) | 495 | WP_003062952.1 | PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB | - |
| M0P28_RS00915 (M0P28_00915) | - | 136247..137095 (+) | 849 | WP_003062954.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| M0P28_RS00920 (M0P28_00920) | - | 137097..137930 (+) | 834 | WP_058692645.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| M0P28_RS00925 (M0P28_00925) | - | 138000..138287 (+) | 288 | WP_003062957.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14891.89 Da Isoelectric Point: 5.7916
>NTDB_id=781672 M0P28_RS00875 WP_013851404.1 129199..129594(+) (ssbA) [Streptococcus pasteurianus strain WUSP074]
MYNKVIMIGRLTAQPELVTTSNEKSVTRVTLAVNRRFKSQNGEREADFISIVVWGRLAETLVSYAGKGSLISIDGELRTR
KYEKDGHTNYVTEVLCHSFQLLESRAQRAMRENNVANDLADLVLEEEELPF
MYNKVIMIGRLTAQPELVTTSNEKSVTRVTLAVNRRFKSQNGEREADFISIVVWGRLAETLVSYAGKGSLISIDGELRTR
KYEKDGHTNYVTEVLCHSFQLLESRAQRAMRENNVANDLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=781672 M0P28_RS00875 WP_013851404.1 129199..129594(+) (ssbA) [Streptococcus pasteurianus strain WUSP074]
ATGTACAATAAAGTTATTATGATTGGTCGTTTGACGGCGCAGCCTGAGCTTGTGACGACGTCAAATGAGAAATCTGTTAC
ACGTGTAACATTAGCAGTTAACCGCCGTTTTAAATCGCAAAATGGTGAGCGTGAGGCTGATTTTATTTCAATTGTGGTTT
GGGGACGTTTAGCAGAAACTCTTGTTTCTTATGCTGGAAAAGGAAGTCTGATTTCGATTGATGGCGAGCTTCGCACACGC
AAATATGAAAAAGATGGTCACACGAATTATGTGACAGAAGTGCTTTGCCATTCTTTCCAACTTTTAGAAAGCCGTGCCCA
ACGTGCTATGCGAGAAAATAATGTGGCAAACGACCTCGCTGATTTAGTTTTGGAAGAGGAAGAATTACCATTTTAA
ATGTACAATAAAGTTATTATGATTGGTCGTTTGACGGCGCAGCCTGAGCTTGTGACGACGTCAAATGAGAAATCTGTTAC
ACGTGTAACATTAGCAGTTAACCGCCGTTTTAAATCGCAAAATGGTGAGCGTGAGGCTGATTTTATTTCAATTGTGGTTT
GGGGACGTTTAGCAGAAACTCTTGTTTCTTATGCTGGAAAAGGAAGTCTGATTTCGATTGATGGCGAGCTTCGCACACGC
AAATATGAAAAAGATGGTCACACGAATTATGTGACAGAAGTGCTTTGCCATTCTTTCCAACTTTTAGAAAGCCGTGCCCA
ACGTGCTATGCGAGAAAATAATGTGGCAAACGACCTCGCTGATTTAGTTTTGGAAGAGGAAGAATTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.153 |
100 |
0.802 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
63.158 |
87.023 |
0.55 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
45.299 |
89.313 |
0.405 |