Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PHA78_RS11055 | Genome accession | NZ_CP116604 |
| Coordinates | 2266895..2267311 (-) | Length | 138 a.a. |
| NCBI ID | WP_272158013.1 | Uniprot ID | - |
| Organism | Streptococcus sp. HN38 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2234808..2282735 | 2266895..2267311 | within | 0 |
Gene organization within MGE regions
Location: 2234808..2282735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA78_RS10845 | - | 2234808..2235299 (-) | 492 | WP_222357305.1 | adenylyltransferase/cytidyltransferase family protein | - |
| PHA78_RS10850 | clpC | 2235418..2237871 (-) | 2454 | WP_272158168.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| PHA78_RS10855 | - | 2237875..2238333 (-) | 459 | WP_024418693.1 | CtsR family transcriptional regulator | - |
| PHA78_RS10860 | - | 2238609..2238953 (+) | 345 | WP_029177107.1 | thioredoxin domain-containing protein | - |
| PHA78_RS10865 | - | 2238947..2239648 (+) | 702 | WP_257059716.1 | GNAT family acetyltransferase | - |
| PHA78_RS10870 | tsf | 2239979..2241019 (-) | 1041 | WP_099806551.1 | translation elongation factor Ts | - |
| PHA78_RS10875 | rpsB | 2241272..2242048 (-) | 777 | WP_014637198.1 | 30S ribosomal protein S2 | - |
| PHA78_RS10885 | - | 2242956..2243180 (+) | 225 | WP_024398726.1 | helix-turn-helix transcriptional regulator | - |
| PHA78_RS10890 | - | 2243324..2244043 (-) | 720 | WP_272158170.1 | CHAP domain-containing protein | - |
| PHA78_RS10895 | - | 2244131..2244373 (-) | 243 | WP_024390532.1 | phage holin | - |
| PHA78_RS10900 | - | 2244379..2244657 (-) | 279 | WP_029744331.1 | hypothetical protein | - |
| PHA78_RS10905 | - | 2244661..2244816 (-) | 156 | WP_153308875.1 | hypothetical protein | - |
| PHA78_RS10910 | - | 2244839..2245273 (-) | 435 | WP_272158171.1 | DUF1366 domain-containing protein | - |
| PHA78_RS10915 | - | 2245286..2247295 (-) | 2010 | WP_272158172.1 | DUF859 family phage minor structural protein | - |
| PHA78_RS10920 | - | 2247315..2250716 (-) | 3402 | WP_272158174.1 | phage tail spike protein | - |
| PHA78_RS10925 | - | 2250713..2251390 (-) | 678 | WP_029188014.1 | phage tail domain-containing protein | - |
| PHA78_RS10930 | - | 2251448..2254852 (-) | 3405 | WP_272158175.1 | phage tail tape measure protein | - |
| PHA78_RS10935 | - | 2254865..2254999 (-) | 135 | WP_257213233.1 | hypothetical protein | - |
| PHA78_RS10940 | - | 2255071..2255403 (-) | 333 | WP_029178006.1 | hypothetical protein | - |
| PHA78_RS10945 | - | 2255416..2256006 (-) | 591 | WP_029178007.1 | hypothetical protein | - |
| PHA78_RS10950 | - | 2256017..2256439 (-) | 423 | WP_029176422.1 | hypothetical protein | - |
| PHA78_RS10955 | - | 2256444..2256815 (-) | 372 | WP_105148950.1 | hypothetical protein | - |
| PHA78_RS10960 | - | 2256778..2257155 (-) | 378 | WP_105148951.1 | phage head-tail adapter protein | - |
| PHA78_RS10965 | - | 2257148..2257447 (-) | 300 | WP_029178009.1 | phage gp6-like head-tail connector protein | - |
| PHA78_RS10970 | - | 2257462..2257752 (-) | 291 | WP_029943528.1 | HeH/LEM domain-containing protein | - |
| PHA78_RS10975 | - | 2257772..2258962 (-) | 1191 | WP_272158178.1 | phage major capsid protein | - |
| PHA78_RS10980 | - | 2258968..2259657 (-) | 690 | WP_029178012.1 | head maturation protease, ClpP-related | - |
| PHA78_RS10985 | - | 2259635..2260894 (-) | 1260 | WP_029176417.1 | phage portal protein | - |
| PHA78_RS10990 | - | 2260924..2261175 (-) | 252 | WP_024414941.1 | hypothetical protein | - |
| PHA78_RS10995 | - | 2261185..2262837 (-) | 1653 | WP_029178013.1 | terminase TerL endonuclease subunit | - |
| PHA78_RS11000 | - | 2262821..2263168 (-) | 348 | WP_024406265.1 | hypothetical protein | - |
| PHA78_RS11005 | - | 2263290..2263514 (-) | 225 | WP_228381580.1 | HNH endonuclease | - |
| PHA78_RS11010 | - | 2263616..2263906 (-) | 291 | WP_029176413.1 | hypothetical protein | - |
| PHA78_RS11015 | - | 2264072..2264647 (-) | 576 | WP_024388816.1 | tyrosine-type recombinase/integrase | - |
| PHA78_RS11020 | - | 2264825..2265289 (-) | 465 | WP_029176412.1 | hypothetical protein | - |
| PHA78_RS11025 | - | 2265261..2265494 (-) | 234 | WP_029176411.1 | hypothetical protein | - |
| PHA78_RS11030 | - | 2265463..2265603 (-) | 141 | WP_153308587.1 | hypothetical protein | - |
| PHA78_RS11035 | - | 2265600..2265851 (-) | 252 | WP_222296894.1 | hypothetical protein | - |
| PHA78_RS11040 | - | 2265848..2266114 (-) | 267 | WP_051178035.1 | hypothetical protein | - |
| PHA78_RS11045 | - | 2266104..2266490 (-) | 387 | WP_024419299.1 | hypothetical protein | - |
| PHA78_RS11050 | - | 2266499..2266885 (-) | 387 | WP_024376884.1 | hypothetical protein | - |
| PHA78_RS11055 | ssb | 2266895..2267311 (-) | 417 | WP_272158013.1 | single-stranded DNA-binding protein | Machinery gene |
| PHA78_RS11060 | - | 2267575..2267796 (-) | 222 | WP_029188048.1 | hypothetical protein | - |
| PHA78_RS11065 | - | 2267789..2268163 (-) | 375 | WP_105202639.1 | YopX family protein | - |
| PHA78_RS11070 | - | 2268303..2268788 (-) | 486 | WP_029188050.1 | DUF1642 domain-containing protein | - |
| PHA78_RS11075 | - | 2268801..2269097 (-) | 297 | WP_029178019.1 | hypothetical protein | - |
| PHA78_RS11080 | - | 2269116..2269277 (-) | 162 | WP_153309547.1 | hypothetical protein | - |
| PHA78_RS11085 | - | 2269279..2270301 (-) | 1023 | WP_272158020.1 | DNA cytosine methyltransferase | - |
| PHA78_RS11090 | - | 2270288..2270482 (-) | 195 | WP_272158021.1 | hypothetical protein | - |
| PHA78_RS11095 | - | 2270469..2270906 (-) | 438 | WP_171997649.1 | hypothetical protein | - |
| PHA78_RS11100 | - | 2270971..2271138 (-) | 168 | WP_153309147.1 | hypothetical protein | - |
| PHA78_RS11105 | - | 2271138..2271329 (-) | 192 | WP_099807271.1 | hypothetical protein | - |
| PHA78_RS11110 | - | 2271316..2272293 (-) | 978 | WP_172034491.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PHA78_RS11115 | - | 2272295..2272441 (-) | 147 | WP_161496873.1 | hypothetical protein | - |
| PHA78_RS11120 | - | 2272444..2272698 (-) | 255 | WP_029172957.1 | hypothetical protein | - |
| PHA78_RS11125 | - | 2272700..2272888 (-) | 189 | WP_029172958.1 | hypothetical protein | - |
| PHA78_RS11130 | - | 2272885..2273169 (-) | 285 | WP_029172959.1 | hypothetical protein | - |
| PHA78_RS11135 | - | 2273212..2273928 (-) | 717 | WP_272158180.1 | phage antirepressor KilAC domain-containing protein | - |
| PHA78_RS11140 | - | 2273992..2274423 (+) | 432 | WP_272158182.1 | hypothetical protein | - |
| PHA78_RS11145 | - | 2274576..2274710 (-) | 135 | WP_261292008.1 | hypothetical protein | - |
| PHA78_RS11150 | - | 2274703..2274900 (-) | 198 | WP_024412305.1 | hypothetical protein | - |
| PHA78_RS11155 | - | 2274887..2275042 (-) | 156 | WP_153309449.1 | hypothetical protein | - |
| PHA78_RS11160 | - | 2275113..2275589 (+) | 477 | WP_228381533.1 | hypothetical protein | - |
| PHA78_RS11165 | - | 2275572..2275736 (-) | 165 | WP_099872423.1 | hypothetical protein | - |
| PHA78_RS11170 | - | 2275820..2276023 (+) | 204 | WP_024376899.1 | hypothetical protein | - |
| PHA78_RS11175 | - | 2276035..2276235 (-) | 201 | WP_029172962.1 | hypothetical protein | - |
| PHA78_RS11180 | - | 2276303..2277025 (+) | 723 | WP_272158184.1 | hypothetical protein | - |
| PHA78_RS11185 | - | 2277018..2277410 (-) | 393 | WP_272158569.1 | hypothetical protein | - |
| PHA78_RS11190 | - | 2277472..2277678 (-) | 207 | WP_024399172.1 | helix-turn-helix transcriptional regulator | - |
| PHA78_RS11195 | - | 2277919..2278497 (-) | 579 | WP_029178224.1 | hypothetical protein | - |
| PHA78_RS11200 | - | 2278657..2278791 (-) | 135 | WP_272158185.1 | hypothetical protein | - |
| PHA78_RS11205 | - | 2278978..2279727 (+) | 750 | WP_272158186.1 | S24 family peptidase | - |
| PHA78_RS11210 | - | 2279741..2280388 (+) | 648 | WP_272158187.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PHA78_RS11215 | - | 2280798..2281400 (+) | 603 | WP_222296883.1 | CD20-like domain-containing protein | - |
| PHA78_RS11220 | - | 2281665..2282735 (+) | 1071 | WP_172093305.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15788.71 Da Isoelectric Point: 4.9059
>NTDB_id=778789 PHA78_RS11055 WP_272158013.1 2266895..2267311(-) (ssb) [Streptococcus sp. HN38]
MINNVVLVGRLTRDVELRYTPSNQAVATFTLAVNRNFKNQSTGEREADFINCVMWRQQAENLANWTKKGHLIAITGRIQT
RSYENQQGQRVYVTEVVAESFQLLEKRDNTANYSSIEEQMPPGMSGQLMDITDDDLPF
MINNVVLVGRLTRDVELRYTPSNQAVATFTLAVNRNFKNQSTGEREADFINCVMWRQQAENLANWTKKGHLIAITGRIQT
RSYENQQGQRVYVTEVVAESFQLLEKRDNTANYSSIEEQMPPGMSGQLMDITDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=778789 PHA78_RS11055 WP_272158013.1 2266895..2267311(-) (ssb) [Streptococcus sp. HN38]
ATGATCAACAATGTTGTATTGGTCGGTAGATTGACGAGGGACGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACTTTGGCGGTTAACCGCAATTTTAAAAATCAATCGACAGGAGAGCGGGAAGCTGACTTTATTAATTGTGTGA
TGTGGCGTCAGCAGGCCGAAAATCTGGCTAATTGGACCAAGAAAGGTCATCTGATTGCTATTACAGGACGAATCCAGACC
AGAAGCTATGAAAATCAGCAAGGGCAACGGGTCTATGTGACAGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCAAGCATCGAAGAGCAGATGCCACCAGGGATGAGCGGTCAGCTGATGGATATTACAGATG
ACGACTTGCCGTTTTAG
ATGATCAACAATGTTGTATTGGTCGGTAGATTGACGAGGGACGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACTTTGGCGGTTAACCGCAATTTTAAAAATCAATCGACAGGAGAGCGGGAAGCTGACTTTATTAATTGTGTGA
TGTGGCGTCAGCAGGCCGAAAATCTGGCTAATTGGACCAAGAAAGGTCATCTGATTGCTATTACAGGACGAATCCAGACC
AGAAGCTATGAAAATCAGCAAGGGCAACGGGTCTATGTGACAGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCAAGCATCGAAGAGCAGATGCCACCAGGGATGAGCGGTCAGCTGATGGATATTACAGATG
ACGACTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.216 |
100 |
0.659 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.023 |
100 |
0.652 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.39 |
100 |
0.464 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.681 |
100 |
0.457 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.681 |
100 |
0.457 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.681 |
100 |
0.457 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.681 |
100 |
0.457 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.681 |
100 |
0.457 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.009 |
77.536 |
0.442 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.153 |
80.435 |
0.428 |
| ssbA | Streptococcus mutans UA159 |
47.748 |
80.435 |
0.384 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
45.455 |
79.71 |
0.362 |