Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | PML83_RS09170 | Genome accession | NZ_CP116575 |
| Coordinates | 1849199..1849474 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain K205-3 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1800004..1849175 | 1849199..1849474 | flank | 24 |
Gene organization within MGE regions
Location: 1800004..1849474
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML83_RS08840 (PML83_08840) | - | 1800004..1802217 (-) | 2214 | WP_002381746.1 | RelA/SpoT family protein | - |
| PML83_RS08845 (PML83_08845) | - | 1802432..1803184 (-) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| PML83_RS08850 (PML83_08850) | prmA | 1803186..1804133 (-) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| PML83_RS08855 (PML83_08855) | - | 1804149..1804634 (-) | 486 | WP_002381745.1 | DUF3013 family protein | - |
| PML83_RS08860 (PML83_08860) | - | 1804591..1805268 (-) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| PML83_RS08865 (PML83_08865) | - | 1805397..1806674 (+) | 1278 | WP_002381744.1 | replication-associated recombination protein A | - |
| PML83_RS08875 (PML83_08875) | - | 1807002..1807280 (+) | 279 | WP_002380425.1 | hypothetical protein | - |
| PML83_RS08880 (PML83_08880) | - | 1807457..1807930 (+) | 474 | WP_202462918.1 | universal stress protein | - |
| PML83_RS08885 (PML83_08885) | - | 1808042..1809229 (-) | 1188 | WP_002362052.1 | acetate/propionate family kinase | - |
| PML83_RS08890 (PML83_08890) | - | 1809254..1810261 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| PML83_RS08895 (PML83_08895) | comGG | 1810390..1810743 (-) | 354 | WP_002381743.1 | competence type IV pilus minor pilin ComGG | - |
| PML83_RS08900 (PML83_08900) | comGF | 1810743..1811177 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| PML83_RS08905 (PML83_08905) | - | 1811167..1811538 (-) | 372 | WP_002365830.1 | type II secretion system protein | - |
| PML83_RS08910 (PML83_08910) | - | 1811872..1811997 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| PML83_RS08915 (PML83_08915) | hemH | 1812294..1813235 (-) | 942 | WP_002365831.1 | ferrochelatase | - |
| PML83_RS08925 (PML83_08925) | - | 1813978..1814229 (-) | 252 | WP_002365832.1 | hypothetical protein | - |
| PML83_RS08930 (PML83_08930) | - | 1814301..1814501 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| PML83_RS08935 (PML83_08935) | - | 1815337..1816596 (-) | 1260 | WP_010730811.1 | LysM peptidoglycan-binding domain-containing protein | - |
| PML83_RS08940 (PML83_08940) | - | 1816609..1816989 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| PML83_RS08945 (PML83_08945) | - | 1817000..1817122 (-) | 123 | WP_010730812.1 | XkdX family protein | - |
| PML83_RS08950 (PML83_08950) | - | 1817124..1817519 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| PML83_RS08955 (PML83_08955) | - | 1817538..1817990 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| PML83_RS08960 (PML83_08960) | - | 1818007..1818747 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| PML83_RS08965 (PML83_08965) | - | 1818753..1820198 (-) | 1446 | WP_010730813.1 | phage tail spike protein | - |
| PML83_RS08970 (PML83_08970) | - | 1820198..1820920 (-) | 723 | WP_010730814.1 | hypothetical protein | - |
| PML83_RS08975 (PML83_08975) | - | 1820917..1825371 (-) | 4455 | WP_010730815.1 | phage tail tape measure protein | - |
| PML83_RS08980 (PML83_08980) | - | 1825358..1825663 (-) | 306 | WP_002366371.1 | hypothetical protein | - |
| PML83_RS08985 (PML83_08985) | - | 1825732..1826130 (-) | 399 | WP_010730816.1 | tail assembly chaperone | - |
| PML83_RS08990 (PML83_08990) | - | 1826193..1826501 (-) | 309 | WP_010730817.1 | hypothetical protein | - |
| PML83_RS08995 (PML83_08995) | - | 1826504..1827109 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| PML83_RS09000 (PML83_09000) | - | 1827128..1827520 (-) | 393 | WP_010730818.1 | tail completion protein gp17 | - |
| PML83_RS09005 (PML83_09005) | - | 1827517..1827855 (-) | 339 | WP_010730819.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PML83_RS09010 (PML83_09010) | - | 1827852..1828127 (-) | 276 | WP_010730820.1 | hypothetical protein | - |
| PML83_RS09015 (PML83_09015) | - | 1828124..1828456 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| PML83_RS09020 (PML83_09020) | - | 1828527..1829423 (-) | 897 | WP_010730821.1 | hypothetical protein | - |
| PML83_RS09025 (PML83_09025) | - | 1829436..1830071 (-) | 636 | WP_010730822.1 | DUF4355 domain-containing protein | - |
| PML83_RS09030 (PML83_09030) | - | 1830194..1831120 (-) | 927 | WP_002364298.1 | minor capsid protein | - |
| PML83_RS09035 (PML83_09035) | - | 1831113..1832597 (-) | 1485 | WP_010730823.1 | phage portal protein | - |
| PML83_RS09040 (PML83_09040) | - | 1832597..1833880 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| PML83_RS09045 (PML83_09045) | - | 1833861..1834295 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| PML83_RS09050 (PML83_09050) | - | 1834327..1834557 (-) | 231 | Protein_1755 | hypothetical protein | - |
| PML83_RS09055 (PML83_09055) | - | 1835114..1835692 (-) | 579 | WP_002392366.1 | hypothetical protein | - |
| PML83_RS09060 (PML83_09060) | - | 1835664..1836557 (-) | 894 | WP_002392365.1 | hypothetical protein | - |
| PML83_RS09070 (PML83_09070) | - | 1837270..1837686 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PML83_RS09075 (PML83_09075) | - | 1838594..1839002 (-) | 409 | Protein_1759 | RusA family crossover junction endodeoxyribonuclease | - |
| PML83_RS09080 (PML83_09080) | - | 1838999..1839856 (-) | 858 | WP_002392361.1 | helix-turn-helix domain-containing protein | - |
| PML83_RS09085 (PML83_09085) | - | 1839856..1840056 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| PML83_RS09090 (PML83_09090) | - | 1840061..1840702 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| PML83_RS09095 (PML83_09095) | - | 1840707..1841441 (-) | 735 | WP_002364345.1 | ERF family protein | - |
| PML83_RS09100 (PML83_09100) | - | 1841434..1841751 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| PML83_RS09105 (PML83_09105) | - | 1841971..1842525 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| PML83_RS09110 (PML83_09110) | - | 1842810..1843148 (-) | 339 | WP_002357003.1 | hypothetical protein | - |
| PML83_RS09115 (PML83_09115) | - | 1843185..1843394 (-) | 210 | WP_002357002.1 | hypothetical protein | - |
| PML83_RS09120 (PML83_09120) | - | 1843449..1843637 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| PML83_RS09125 (PML83_09125) | - | 1843663..1844388 (-) | 726 | WP_010730824.1 | ORF6C domain-containing protein | - |
| PML83_RS09130 (PML83_09130) | - | 1844427..1844738 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| PML83_RS14745 | - | 1844750..1844917 (-) | 168 | WP_002388204.1 | hypothetical protein | - |
| PML83_RS09135 (PML83_09135) | - | 1845335..1845532 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| PML83_RS09140 (PML83_09140) | - | 1845545..1845727 (-) | 183 | WP_002358110.1 | hypothetical protein | - |
| PML83_RS09145 (PML83_09145) | - | 1846025..1846357 (+) | 333 | WP_002392358.1 | helix-turn-helix domain-containing protein | - |
| PML83_RS09150 (PML83_09150) | - | 1846375..1846719 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PML83_RS09155 (PML83_09155) | - | 1846755..1847483 (+) | 729 | WP_002378468.1 | ion transporter | - |
| PML83_RS09160 (PML83_09160) | - | 1847583..1848731 (+) | 1149 | WP_002388210.1 | tyrosine-type recombinase/integrase | - |
| PML83_RS09165 (PML83_09165) | comGD | 1848759..1849202 (-) | 444 | WP_025192396.1 | competence type IV pilus minor pilin ComGD | - |
| PML83_RS09170 (PML83_09170) | comGC/cglC | 1849199..1849474 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=778515 PML83_RS09170 WP_002356991.1 1849199..1849474(-) (comGC/cglC) [Enterococcus faecalis strain K205-3]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=778515 PML83_RS09170 WP_002356991.1 1849199..1849474(-) (comGC/cglC) [Enterococcus faecalis strain K205-3]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |