Detailed information NTG0763219

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: OZE10_RS09385
• Genome accession: NZ_CP113831
• Coordinates: 1807912..1808187 (-)
• Length: 91 a.a.
• NCBI ID: WP_002356991.1
• Uniprot ID: A0A1B4XPV0
• Organism: Enterococcus faecalis strain T30
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1802912..1813187

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OZE10_RS09350 (OZE10_09350)	-	1803467..1803940 (+)	474	WP_002357065.1	universal stress protein	-
OZE10_RS09355 (OZE10_09355)	-	1804052..1805239 (-)	1188	WP_002357064.1	acetate/propionate family kinase	-
OZE10_RS09360 (OZE10_09360)	-	1805264..1806271 (-)	1008	WP_002357063.1	class I SAM-dependent methyltransferase	-
OZE10_RS09365 (OZE10_09365)	comGG	1806400..1806753 (-)	354	WP_002357061.1	competence type IV pilus minor pilin ComGG	-
OZE10_RS09370 (OZE10_09370)	comGF	1806753..1807187 (-)	435	WP_002357060.1	competence type IV pilus minor pilin ComGF	-
OZE10_RS09375 (OZE10_09375)	-	1807177..1807503 (-)	327	WP_002393943.1	type II secretion system protein	-
OZE10_RS09380 (OZE10_09380)	comGD	1807469..1807915 (-)	447	WP_002379576.1	competence type IV pilus minor pilin ComGD	-
OZE10_RS09385 (OZE10_09385)	comGC/cglC	1807912..1808187 (-)	276	WP_002356991.1	competence type IV pilus major pilin ComGC	Machinery gene
OZE10_RS09390 (OZE10_09390)	comGB	1808187..1809233 (-)	1047	WP_047649127.1	competence type IV pilus assembly protein ComGB	-
OZE10_RS09395 (OZE10_09395)	comGA	1809190..1810158 (-)	969	WP_002401324.1	competence type IV pilus ATPase ComGA	-
OZE10_RS09400 (OZE10_09400)	-	1810399..1811727 (-)	1329	WP_002362058.1	APC family permease	-
OZE10_RS09405 (OZE10_09405)	rlmN	1812017..1813090 (-)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.41 Da
• Isoelectric Point: 9.3192

>NTDB_id=763219 OZE10_RS09385 WP_002356991.1 1807912..1808187(-) (comGC/cglC) [Enterococcus faecalis strain T30]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=763219 OZE10_RS09385 WP_002356991.1 1807912..1808187(-) (comGC/cglC) [Enterococcus faecalis strain T30]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

3D structure

• AlphaFold DB: A0A1B4XPV0

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	46.835	86.813	0.407
comGC	Staphylococcus aureus N315	46.835	86.813	0.407
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396