NTDB

Overview

Name	ssbB	Type	Machinery gene
Locus tag	OU809_RS19210	Genome accession	NZ_CP113516
Coordinates	3821751..3822098 (-)	Length	115 a.a.
NCBI ID	WP_020453204.1	Uniprot ID	A0AAW6K4M3
Organism	Bacillus paralicheniformis strain 285-3
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 3816751..3827098

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OU809_RS19180 (OU809_19180)	srlD	3817365..3818150 (-)	786	WP_035337858.1	sorbitol-6-phosphate dehydrogenase	-
OU809_RS19185 (OU809_19185)	-	3818165..3818536 (-)	372	WP_020453199.1	PTS glucitol/sorbitol transporter subunit IIA	-
OU809_RS19190 (OU809_19190)	-	3818560..3819567 (-)	1008	WP_026580213.1	PTS glucitol/sorbitol transporter subunit IIB	-
OU809_RS19195 (OU809_19195)	-	3819584..3820132 (-)	549	WP_020453201.1	PTS glucitol/sorbitol transporter subunit IIC	-
OU809_RS19200 (OU809_19200)	-	3820129..3820572 (-)	444	WP_020453202.1	transcriptional regulator GutM	-
OU809_RS19205 (OU809_19205)	-	3820569..3821531 (-)	963	WP_020453203.1	sugar-binding transcriptional regulator	-
OU809_RS19210 (OU809_19210)	ssbB	3821751..3822098 (-)	348	WP_020453204.1	single-stranded DNA-binding protein	Machinery gene
OU809_RS19215 (OU809_19215)	-	3822203..3822574 (-)	372	WP_023857133.1	hypothetical protein	-
OU809_RS19220 (OU809_19220)	-	3822756..3823169 (+)	414	WP_020453206.1	YwpF-like family protein	-
OU809_RS19225 (OU809_19225)	mscL	3823209..3823589 (-)	381	WP_023857132.1	large conductance mechanosensitive channel protein MscL	-
OU809_RS19230 (OU809_19230)	fabZ	3823661..3824095 (-)	435	WP_003185902.1	3-hydroxyacyl-ACP dehydratase FabZ	-
OU809_RS19235 (OU809_19235)	-	3824277..3825104 (-)	828	WP_268050912.1	flagellar hook-basal body protein	-
OU809_RS19240 (OU809_19240)	-	3825148..3825987 (-)	840	WP_095291470.1	flagellar hook-basal body protein	-

Sequence

Protein

Download Length: 115 a.a. Molecular weight: 12795.52 Da Isoelectric Point: 6.9543

                                >NTDB_id=762634 OU809_RS19210 WP_020453204.1 3821751..3822098(-) (ssbB) [Bacillus paralicheniformis strain 285-3]

MFNEIMLVGRLTKDPELRYTSDGVPVANVTLAVSRPFKNAAGEIEADFVNCTLWRKTAVNTAEYCEKGSIIGLSGRIQTR

QYVNSEGERVFITEVVARSVRFLGESRKAHEPSEA

Nucleotide

Download Length: 348 bp

                                >NTDB_id=762634 OU809_RS19210 WP_020453204.1 3821751..3822098(-) (ssbB) [Bacillus paralicheniformis strain 285-3]

ATGTTTAATGAGATCATGCTGGTCGGGCGTTTGACAAAAGATCCCGAACTTCGGTACACATCTGACGGTGTCCCTGTTGC

AAATGTGACGCTGGCTGTCAGCAGGCCTTTCAAAAATGCAGCAGGCGAAATTGAAGCGGACTTTGTCAATTGCACCCTGT

GGCGCAAAACTGCCGTGAATACAGCCGAATATTGCGAAAAAGGCTCCATCATCGGGCTGAGCGGAAGAATCCAGACTCGC

CAATACGTCAATTCAGAAGGCGAACGCGTCTTTATTACAGAAGTTGTCGCCCGATCAGTCAGATTTTTGGGAGAAAGCCG

AAAAGCCCATGAGCCGTCGGAAGCTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	72.816	89.565	0.652
ssbA	Bacillus subtilis subsp. subtilis str. 168	60.194	89.565	0.539
ssb	Latilactobacillus sakei subsp. sakei 23K	52.252	96.522	0.504
ssbA	Streptococcus mutans UA159	45.794	93.043	0.426
ssbB	Lactococcus lactis subsp. cremoris KW2	44.34	92.174	0.409
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.925	93.043	0.409
ssbB/cilA	Streptococcus mitis NCTC 12261	42.991	93.043	0.4
ssbB/cilA	Streptococcus pneumoniae TIGR4	42.991	93.043	0.4
ssbB/cilA	Streptococcus pneumoniae Rx1	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae D39	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae R6	42.056	93.043	0.391
ssbB/cilA	Streptococcus mitis SK321	42.056	93.043	0.391

Detailed information NTG0762634