NTDB

Overview

Name	ssbB	Type	Machinery gene
Locus tag	OPU65_RS17195	Genome accession	NZ_CP110812
Coordinates	3332795..3333142 (+)	Length	115 a.a.
NCBI ID	WP_265625454.1	Uniprot ID	-
Organism	Bacillus paralicheniformis strain CamBx3
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 3327795..3338142

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OPU65_RS17165 (OPU65_17165)	-	3328905..3329744 (+)	840	WP_075751539.1	flagellar hook-basal body protein	-
OPU65_RS17170 (OPU65_17170)	-	3329788..3330615 (+)	828	WP_265625453.1	flagellar hook-basal body protein	-
OPU65_RS17175 (OPU65_17175)	fabZ	3330797..3331231 (+)	435	WP_003185902.1	3-hydroxyacyl-ACP dehydratase FabZ	-
OPU65_RS17180 (OPU65_17180)	mscL	3331304..3331684 (+)	381	WP_020453207.1	large conductance mechanosensitive channel protein MscL	-
OPU65_RS17185 (OPU65_17185)	-	3331724..3332137 (-)	414	WP_020453206.1	YwpF-like family protein	-
OPU65_RS17190 (OPU65_17190)	-	3332319..3332690 (+)	372	WP_020453205.1	hypothetical protein	-
OPU65_RS17195 (OPU65_17195)	ssbB	3332795..3333142 (+)	348	WP_265625454.1	single-stranded DNA-binding protein	Machinery gene
OPU65_RS17200 (OPU65_17200)	-	3333429..3334327 (+)	899	Protein_3369	sugar-binding transcriptional regulator	-
OPU65_RS17205 (OPU65_17205)	-	3334324..3334767 (+)	444	WP_152846338.1	transcriptional regulator GutM	-
OPU65_RS17210 (OPU65_17210)	-	3334764..3335312 (+)	549	WP_043925087.1	PTS glucitol/sorbitol transporter subunit IIC	-
OPU65_RS17215 (OPU65_17215)	-	3335329..3336336 (+)	1008	WP_165428273.1	PTS glucitol/sorbitol transporter subunit IIB	-
OPU65_RS17220 (OPU65_17220)	-	3336360..3336731 (+)	372	WP_243941828.1	PTS glucitol/sorbitol transporter subunit IIA	-
OPU65_RS17225 (OPU65_17225)	srlD	3336746..3337531 (+)	786	WP_265625455.1	sorbitol-6-phosphate dehydrogenase	-

Sequence

Protein

Download Length: 115 a.a. Molecular weight: 12783.51 Da Isoelectric Point: 6.9543

                                >NTDB_id=756385 OPU65_RS17195 WP_265625454.1 3332795..3333142(+) (ssbB) [Bacillus paralicheniformis strain CamBx3]

MFNEIMLVGRLTKDPELRYTSDGVPVANVTLAISRSFKNAAGEIEADFVNCTLWRKTAVNTAEYCEKGSIIGLSGRIQTR

QYVNSEGERVFITEVVARSVRFLGESRKAHEPAEA

Nucleotide

Download Length: 348 bp

                                >NTDB_id=756385 OPU65_RS17195 WP_265625454.1 3332795..3333142(+) (ssbB) [Bacillus paralicheniformis strain CamBx3]

ATGTTTAATGAGATCATGCTGGTCGGGCGTTTGACTAAAGATCCCGAACTTCGGTACACATCTGACGGTGTCCCTGTTGC

AAATGTGACGCTGGCTATCAGCAGGTCTTTCAAAAATGCAGCAGGCGAAATTGAAGCGGACTTTGTCAATTGCACCCTCT

GGCGCAAAACTGCCGTGAACACAGCCGAATATTGCGAAAAAGGCTCCATCATCGGGCTGAGCGGAAGAATCCAGACTCGC

CAATACGTCAATTCAGAAGGCGAACGCGTCTTTATTACAGAAGTTGTCGCACGGTCAGTCAGGTTTTTGGGAGAAAGCCG

AAAAGCGCATGAGCCGGCGGAAGCTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	72.816	89.565	0.652
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.223	89.565	0.53
ssb	Latilactobacillus sakei subsp. sakei 23K	51.351	96.522	0.496
ssbA	Streptococcus mutans UA159	44.86	93.043	0.417
ssbB	Streptococcus sobrinus strain NIDR 6715-7	42.991	93.043	0.4
ssbB	Lactococcus lactis subsp. cremoris KW2	43.396	92.174	0.4
ssbB/cilA	Streptococcus mitis NCTC 12261	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae TIGR4	42.056	93.043	0.391
ssbB/cilA	Streptococcus pneumoniae Rx1	41.121	93.043	0.383
ssbB/cilA	Streptococcus pneumoniae D39	41.121	93.043	0.383
ssbB/cilA	Streptococcus pneumoniae R6	41.121	93.043	0.383
ssbB/cilA	Streptococcus mitis SK321	41.121	93.043	0.383

Detailed information NTG0756385