Detailed information NTG0756099

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: OP858_RS06220
• Genome accession: NZ_CP110784
• Coordinates: 1258199..1258510 (+)
• Length: 103 a.a.
• NCBI ID: WP_029625707.1
• Uniprot ID: -
• Organism: Staphylococcus capitis strain CCSM0123
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1253199..1263510

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OP858_RS06190 (OP858_06190)	-	1253972..1254175 (+)	204	WP_002453337.1	YqgQ family protein	-
OP858_RS06195 (OP858_06195)	-	1254172..1255158 (+)	987	WP_267263329.1	ROK family glucokinase	-
OP858_RS06200 (OP858_06200)	-	1255158..1255484 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
OP858_RS06205 (OP858_06205)	-	1255484..1256107 (+)	624	WP_002453335.1	MBL fold metallo-hydrolase	-
OP858_RS06210 (OP858_06210)	comGA	1256165..1257139 (+)	975	WP_002453334.1	competence type IV pilus ATPase ComGA	Machinery gene
OP858_RS06215 (OP858_06215)	comGB	1257111..1258180 (+)	1070	Protein_1177	competence type IV pilus assembly protein ComGB	-
OP858_RS06220 (OP858_06220)	comGC	1258199..1258510 (+)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
OP858_RS06225 (OP858_06225)	comGD	1258500..1258937 (+)	438	WP_410482995.1	competence type IV pilus minor pilin ComGD	-
OP858_RS06230 (OP858_06230)	-	1259026..1259223 (+)	198	WP_267263331.1	hypothetical protein	-
OP858_RS06235 (OP858_06235)	-	1259213..1259548 (+)	336	WP_231138593.1	ComGF family competence protein	-
OP858_RS06245 (OP858_06245)	-	1259801..1260310 (+)	510	WP_029625706.1	shikimate kinase	-
OP858_RS06250 (OP858_06250)	gcvT	1260519..1261610 (+)	1092	WP_016898186.1	glycine cleavage system aminomethyltransferase GcvT	-
OP858_RS06255 (OP858_06255)	gcvPA	1261629..1262975 (+)	1347	WP_002453328.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.43 Da
• Isoelectric Point: 9.7122

>NTDB_id=756099 OP858_RS06220 WP_029625707.1 1258199..1258510(+) (comGC) [Staphylococcus capitis strain CCSM0123]
MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI
KEGQKNCKSGQTISISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=756099 OP858_RS06220 WP_029625707.1 1258199..1258510(+) (comGC) [Staphylococcus capitis strain CCSM0123]
ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATAATTAGTTTATTACT
TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA
ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA
AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369