Detailed information NTG0075304

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: GOZ47_RS05475
• Genome accession: NZ_AP021885
• Coordinates: 1215165..1215440 (-)
• Length: 91 a.a.
• NCBI ID: WP_015694726.1
• Uniprot ID: -
• Organism: Melissococcus plutonius strain DAT1033
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1210165..1220440

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GOZ47_RS05445 (DAT1033_1104)	-	1211137..1212330 (-)	1194	WP_013774252.1	acetate kinase	-
GOZ47_RS05450 (DAT1033_1105)	-	1212359..1213366 (-)	1008	Protein_1082	class I SAM-dependent methyltransferase	-
GOZ47_RS09835 (DAT1033_1106)	comGG	1213646..1213927 (-)	282	Protein_1083	competence type IV pilus minor pilin ComGG	-
GOZ47_RS05460 (DAT1033_1107)	comGF	1213982..1214422 (-)	441	WP_053078829.1	competence type IV pilus minor pilin ComGF	-
GOZ47_RS05465 (DAT1033_1108)	-	1214403..1214747 (-)	345	WP_041363232.1	hypothetical protein	-
GOZ47_RS05470 (DAT1033_1109)	comGD	1214764..1215168 (-)	405	WP_013774256.1	competence type IV pilus minor pilin ComGD	-
GOZ47_RS05475 (DAT1033_1110)	comGC/cglC	1215165..1215440 (-)	276	WP_015694726.1	competence type IV pilus major pilin ComGC	Machinery gene
GOZ47_RS05480 (DAT1033_1111)	comGB	1215437..1216465 (-)	1029	WP_013774318.1	competence type IV pilus assembly protein ComGB	-
GOZ47_RS05485 (DAT1033_1112)	comGA	1216419..1217399 (-)	981	WP_013774319.1	competence type IV pilus ATPase ComGA	-
GOZ47_RS05490 (DAT1033_1113)	-	1217939..1218892 (-)	954	WP_048589938.1	metal ABC transporter substrate-binding protein	-
GOZ47_RS05495 (DAT1033_1114)	-	1218889..1219731 (-)	843	WP_127515687.1	metal ABC transporter permease	-
GOZ47_RS05500 (DAT1033_1115)	-	1219728..1220440 (-)	713	Protein_1092	metal ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10652.66 Da
• Isoelectric Point: 9.6586

>NTDB_id=75304 GOZ47_RS05475 WP_015694726.1 1215165..1215440(-) (comGC/cglC) [Melissococcus plutonius strain DAT1033]
MKKRSWHKGFTLLEMLIVLLILSVLILLFVPNLAKQKETIDQKGNEAIVKVIEAQMELYELDKNVKPSAEQLLTEKYITK
DQYEKYQTAKK

Nucleotide

• Length: 276 bp

>NTDB_id=75304 GOZ47_RS05475 WP_015694726.1 1215165..1215440(-) (comGC/cglC) [Melissococcus plutonius strain DAT1033]
ATGAAAAAGCGATCTTGGCACAAAGGATTTACCTTATTGGAAATGCTCATTGTTTTGCTTATTCTTTCTGTTTTAATTTT
GTTATTTGTTCCAAATCTAGCAAAACAAAAAGAAACAATTGATCAAAAAGGAAATGAAGCAATTGTTAAAGTTATTGAAG
CACAAATGGAATTATATGAATTAGACAAAAATGTAAAACCTTCTGCTGAACAATTATTAACGGAAAAATACATTACTAAA
GATCAATATGAAAAATATCAAACAGCTAAAAAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	55.294	93.407	0.516
comGC/cglC	Streptococcus mitis NCTC 12261	55.294	93.407	0.516
comYC	Streptococcus suis isolate S10	55.952	92.308	0.516
comGC/cglC	Streptococcus pneumoniae R6	54.118	93.407	0.505
comGC/cglC	Streptococcus pneumoniae TIGR4	54.118	93.407	0.505
comGC/cglC	Streptococcus pneumoniae Rx1	54.118	93.407	0.505
comGC/cglC	Streptococcus pneumoniae D39	54.118	93.407	0.505
comYC	Streptococcus gordonii str. Challis substr. CH1	54.217	91.209	0.495
comGC	Lactococcus lactis subsp. cremoris KW2	55	87.912	0.484
comYC	Streptococcus mutans UA140	49.412	93.407	0.462
comYC	Streptococcus mutans UA159	49.412	93.407	0.462
comGC	Latilactobacillus sakei subsp. sakei 23K	45.238	92.308	0.418
comGC	Bacillus subtilis subsp. subtilis str. 168	48	82.418	0.396
comGC	Staphylococcus aureus MW2	44.737	83.516	0.374
comGC	Staphylococcus aureus N315	44.737	83.516	0.374