Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | OLL88_RS05780 | Genome accession | NZ_CP110072 |
| Coordinates | 1238140..1238415 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain BE7 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1238439..1277926 | 1238140..1238415 | flank | 24 |
Gene organization within MGE regions
Location: 1238140..1277926
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL88_RS05780 (OLL88_05780) | comGC/cglC | 1238140..1238415 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| OLL88_RS05785 (OLL88_05785) | comGD | 1238412..1238846 (+) | 435 | Protein_1135 | competence type IV pilus minor pilin ComGD | - |
| OLL88_RS05790 (OLL88_05790) | - | 1238883..1240031 (-) | 1149 | WP_002378469.1 | site-specific integrase | - |
| OLL88_RS05795 (OLL88_05795) | - | 1240131..1240859 (-) | 729 | WP_002378468.1 | ion transporter | - |
| OLL88_RS05800 (OLL88_05800) | - | 1240895..1241239 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OLL88_RS05805 (OLL88_05805) | - | 1241256..1241588 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| OLL88_RS05810 (OLL88_05810) | - | 1241900..1242076 (+) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL88_RS05815 (OLL88_05815) | - | 1242087..1242398 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL88_RS05820 (OLL88_05820) | - | 1242437..1243162 (+) | 726 | WP_002378466.1 | phage regulatory protein | - |
| OLL88_RS05825 (OLL88_05825) | - | 1243188..1243376 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| OLL88_RS05830 (OLL88_05830) | - | 1243431..1243640 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| OLL88_RS05835 (OLL88_05835) | - | 1243677..1243871 (+) | 195 | WP_002378464.1 | hypothetical protein | - |
| OLL88_RS05840 (OLL88_05840) | - | 1244298..1244852 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| OLL88_RS05845 (OLL88_05845) | - | 1245072..1245389 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| OLL88_RS05850 (OLL88_05850) | - | 1245382..1246116 (+) | 735 | WP_002378463.1 | ERF family protein | - |
| OLL88_RS05855 (OLL88_05855) | - | 1246121..1246762 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| OLL88_RS05860 (OLL88_05860) | - | 1246767..1246967 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| OLL88_RS05865 (OLL88_05865) | - | 1246967..1247824 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| OLL88_RS05870 (OLL88_05870) | - | 1247821..1248228 (+) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OLL88_RS05875 (OLL88_05875) | - | 1249136..1249552 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OLL88_RS05885 (OLL88_05885) | - | 1250267..1251175 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| OLL88_RS05890 (OLL88_05890) | - | 1251292..1251654 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| OLL88_RS05895 (OLL88_05895) | - | 1252125..1252355 (+) | 231 | Protein_1156 | hypothetical protein | - |
| OLL88_RS05900 (OLL88_05900) | - | 1252387..1252821 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| OLL88_RS05905 (OLL88_05905) | - | 1252802..1254085 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| OLL88_RS05910 (OLL88_05910) | - | 1254085..1255569 (+) | 1485 | WP_002378458.1 | phage portal protein | - |
| OLL88_RS05915 (OLL88_05915) | - | 1255562..1256488 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| OLL88_RS05920 (OLL88_05920) | - | 1256611..1257246 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| OLL88_RS05925 (OLL88_05925) | - | 1257260..1258156 (+) | 897 | WP_002378455.1 | hypothetical protein | - |
| OLL88_RS05930 (OLL88_05930) | - | 1258227..1258559 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| OLL88_RS05935 (OLL88_05935) | - | 1258556..1258831 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| OLL88_RS05940 (OLL88_05940) | - | 1258828..1259166 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OLL88_RS05945 (OLL88_05945) | - | 1259163..1259555 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| OLL88_RS05950 (OLL88_05950) | - | 1259574..1260179 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| OLL88_RS05955 (OLL88_05955) | - | 1260182..1260364 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| OLL88_RS05960 (OLL88_05960) | - | 1260413..1260985 (+) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| OLL88_RS05965 (OLL88_05965) | - | 1261039..1261437 (+) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| OLL88_RS05970 (OLL88_05970) | - | 1261506..1261811 (+) | 306 | WP_002366371.1 | hypothetical protein | - |
| OLL88_RS05975 (OLL88_05975) | - | 1261798..1266252 (+) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| OLL88_RS05980 (OLL88_05980) | - | 1266249..1266971 (+) | 723 | WP_002363380.1 | hypothetical protein | - |
| OLL88_RS05985 (OLL88_05985) | - | 1266971..1268416 (+) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| OLL88_RS05990 (OLL88_05990) | - | 1268422..1269162 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| OLL88_RS05995 (OLL88_05995) | - | 1269179..1269631 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| OLL88_RS06000 (OLL88_06000) | - | 1269650..1270045 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| OLL88_RS06005 (OLL88_06005) | - | 1270047..1270169 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| OLL88_RS06010 (OLL88_06010) | - | 1270180..1270560 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| OLL88_RS06015 (OLL88_06015) | - | 1270573..1271832 (+) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| OLL88_RS06020 (OLL88_06020) | - | 1272685..1272885 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| OLL88_RS06025 (OLL88_06025) | - | 1272957..1273229 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| OLL88_RS06035 (OLL88_06035) | hemH | 1273945..1274886 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| OLL88_RS06040 (OLL88_06040) | - | 1275687..1276013 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| OLL88_RS06045 (OLL88_06045) | comGF | 1276003..1276437 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| OLL88_RS06050 (OLL88_06050) | comGG | 1276437..1276790 (+) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| OLL88_RS06055 (OLL88_06055) | - | 1276919..1277926 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=752080 OLL88_RS05780 WP_002356991.1 1238140..1238415(+) (comGC/cglC) [Enterococcus faecalis strain BE7]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=752080 OLL88_RS05780 WP_002356991.1 1238140..1238415(+) (comGC/cglC) [Enterococcus faecalis strain BE7]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |