Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | OLL94_RS05480 | Genome accession | NZ_CP110071 |
| Coordinates | 1194856..1195131 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain BE8 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1195155..1244031 | 1194856..1195131 | flank | 24 |
Gene organization within MGE regions
Location: 1194856..1244031
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL94_RS05480 (OLL94_05480) | comGC/cglC | 1194856..1195131 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| OLL94_RS05485 (OLL94_05485) | comGD | 1195128..1195562 (+) | 435 | Protein_1077 | competence type IV pilus minor pilin ComGD | - |
| OLL94_RS05490 (OLL94_05490) | - | 1195599..1196747 (-) | 1149 | WP_002378469.1 | site-specific integrase | - |
| OLL94_RS05495 (OLL94_05495) | - | 1196847..1197575 (-) | 729 | WP_002378468.1 | ion transporter | - |
| OLL94_RS05500 (OLL94_05500) | - | 1197611..1197955 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OLL94_RS05505 (OLL94_05505) | - | 1197972..1198304 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| OLL94_RS05510 (OLL94_05510) | - | 1198616..1198792 (+) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL94_RS05515 (OLL94_05515) | - | 1198803..1199114 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL94_RS05520 (OLL94_05520) | - | 1199153..1199878 (+) | 726 | WP_002378466.1 | phage regulatory protein | - |
| OLL94_RS05525 (OLL94_05525) | - | 1199904..1200092 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| OLL94_RS05530 (OLL94_05530) | - | 1200147..1200356 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| OLL94_RS05535 (OLL94_05535) | - | 1200393..1200587 (+) | 195 | WP_002378464.1 | hypothetical protein | - |
| OLL94_RS05540 (OLL94_05540) | - | 1201014..1201568 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| OLL94_RS05545 (OLL94_05545) | - | 1201788..1202105 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| OLL94_RS05550 (OLL94_05550) | - | 1202098..1202832 (+) | 735 | WP_002378463.1 | ERF family protein | - |
| OLL94_RS05555 (OLL94_05555) | - | 1202837..1203478 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| OLL94_RS05560 (OLL94_05560) | - | 1203483..1203683 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| OLL94_RS05565 (OLL94_05565) | - | 1203683..1204540 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| OLL94_RS05570 (OLL94_05570) | - | 1204537..1204944 (+) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OLL94_RS05575 (OLL94_05575) | - | 1205852..1206268 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OLL94_RS05585 (OLL94_05585) | - | 1206983..1207891 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| OLL94_RS05590 (OLL94_05590) | - | 1208008..1208370 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| OLL94_RS05595 (OLL94_05595) | - | 1208841..1209071 (+) | 231 | Protein_1098 | hypothetical protein | - |
| OLL94_RS05600 (OLL94_05600) | - | 1209103..1209537 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| OLL94_RS05605 (OLL94_05605) | - | 1209518..1210801 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| OLL94_RS05610 (OLL94_05610) | - | 1210801..1212285 (+) | 1485 | WP_002378458.1 | phage portal protein | - |
| OLL94_RS05615 (OLL94_05615) | - | 1212278..1213204 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| OLL94_RS05620 (OLL94_05620) | - | 1213327..1213962 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| OLL94_RS05625 (OLL94_05625) | - | 1213976..1214872 (+) | 897 | WP_002378455.1 | hypothetical protein | - |
| OLL94_RS05630 (OLL94_05630) | - | 1214943..1215275 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| OLL94_RS05635 (OLL94_05635) | - | 1215272..1215547 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| OLL94_RS05640 (OLL94_05640) | - | 1215544..1215882 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OLL94_RS05645 (OLL94_05645) | - | 1215879..1216271 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| OLL94_RS05650 (OLL94_05650) | - | 1216290..1216895 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| OLL94_RS05655 (OLL94_05655) | - | 1216898..1217080 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| OLL94_RS05660 (OLL94_05660) | - | 1217129..1217701 (+) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| OLL94_RS05665 (OLL94_05665) | - | 1217755..1218153 (+) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| OLL94_RS05670 (OLL94_05670) | - | 1218222..1218527 (+) | 306 | WP_002366371.1 | hypothetical protein | - |
| OLL94_RS05675 (OLL94_05675) | - | 1218514..1222968 (+) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| OLL94_RS05680 (OLL94_05680) | - | 1222965..1223687 (+) | 723 | WP_002363380.1 | hypothetical protein | - |
| OLL94_RS05685 (OLL94_05685) | - | 1223687..1225132 (+) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| OLL94_RS05690 (OLL94_05690) | - | 1225138..1225878 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| OLL94_RS05695 (OLL94_05695) | - | 1225895..1226347 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| OLL94_RS05700 (OLL94_05700) | - | 1226366..1226761 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| OLL94_RS05705 (OLL94_05705) | - | 1226763..1226885 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| OLL94_RS05710 (OLL94_05710) | - | 1226896..1227276 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| OLL94_RS05715 (OLL94_05715) | - | 1227289..1228548 (+) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| OLL94_RS05720 (OLL94_05720) | - | 1229401..1229601 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| OLL94_RS05725 (OLL94_05725) | - | 1229673..1229945 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| OLL94_RS05735 (OLL94_05735) | hemH | 1230661..1231602 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| OLL94_RS05740 (OLL94_05740) | - | 1232403..1232729 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| OLL94_RS05745 (OLL94_05745) | comGF | 1232719..1233153 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| OLL94_RS05750 (OLL94_05750) | comGG | 1233153..1233506 (+) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| OLL94_RS05755 (OLL94_05755) | - | 1233635..1234642 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| OLL94_RS05760 (OLL94_05760) | - | 1234667..1235854 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| OLL94_RS05765 (OLL94_05765) | - | 1235966..1236439 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| OLL94_RS05770 (OLL94_05770) | - | 1236755..1237087 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| OLL94_RS05780 (OLL94_05780) | - | 1237361..1238638 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| OLL94_RS05785 (OLL94_05785) | - | 1238767..1239444 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| OLL94_RS05790 (OLL94_05790) | - | 1239401..1239886 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| OLL94_RS05795 (OLL94_05795) | prmA | 1239902..1240849 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| OLL94_RS05800 (OLL94_05800) | - | 1240851..1241603 (+) | 753 | WP_002378439.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| OLL94_RS05805 (OLL94_05805) | - | 1241818..1244031 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=752042 OLL94_RS05480 WP_002356991.1 1194856..1195131(+) (comGC/cglC) [Enterococcus faecalis strain BE8]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=752042 OLL94_RS05480 WP_002356991.1 1194856..1195131(+) (comGC/cglC) [Enterococcus faecalis strain BE8]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |