Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | OLL92_RS07255 | Genome accession | NZ_CP110059 |
| Coordinates | 1489883..1490158 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain BE16 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1490182..1528716 | 1489883..1490158 | flank | 24 |
Gene organization within MGE regions
Location: 1489883..1528716
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL92_RS07255 (OLL92_07255) | comGC/cglC | 1489883..1490158 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| OLL92_RS07260 (OLL92_07260) | comGD | 1490155..1490589 (+) | 435 | Protein_1412 | competence type IV pilus minor pilin ComGD | - |
| OLL92_RS07265 (OLL92_07265) | - | 1490626..1491774 (-) | 1149 | WP_002378469.1 | site-specific integrase | - |
| OLL92_RS07270 (OLL92_07270) | - | 1491874..1492602 (-) | 729 | WP_002381717.1 | potassium channel family protein | - |
| OLL92_RS07275 (OLL92_07275) | - | 1492638..1492982 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OLL92_RS07280 (OLL92_07280) | - | 1492999..1493331 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| OLL92_RS07285 (OLL92_07285) | - | 1493643..1493819 (+) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL92_RS07290 (OLL92_07290) | - | 1493830..1494141 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL92_RS07295 (OLL92_07295) | - | 1494180..1494902 (+) | 723 | WP_002410531.1 | Rha family transcriptional regulator | - |
| OLL92_RS07300 (OLL92_07300) | - | 1494928..1495116 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| OLL92_RS07305 (OLL92_07305) | - | 1495171..1495380 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| OLL92_RS07310 (OLL92_07310) | - | 1495417..1495755 (+) | 339 | WP_002402484.1 | hypothetical protein | - |
| OLL92_RS07315 (OLL92_07315) | - | 1495951..1496268 (+) | 318 | WP_002402485.1 | hypothetical protein | - |
| OLL92_RS07320 (OLL92_07320) | - | 1496261..1496995 (+) | 735 | WP_002402486.1 | ERF family protein | - |
| OLL92_RS07325 (OLL92_07325) | - | 1497000..1497641 (+) | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| OLL92_RS07330 (OLL92_07330) | - | 1497646..1497846 (+) | 201 | WP_010715320.1 | hypothetical protein | - |
| OLL92_RS07335 (OLL92_07335) | - | 1497846..1498706 (+) | 861 | WP_002402489.1 | helix-turn-helix domain-containing protein | - |
| OLL92_RS07340 (OLL92_07340) | - | 1498703..1499005 (+) | 303 | WP_002368214.1 | hypothetical protein | - |
| OLL92_RS07345 (OLL92_07345) | - | 1499006..1499305 (+) | 300 | WP_002402490.1 | MazG-like family protein | - |
| OLL92_RS07350 (OLL92_07350) | - | 1499314..1499748 (+) | 435 | WP_002402491.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OLL92_RS07355 (OLL92_07355) | - | 1500655..1501071 (+) | 417 | WP_010785402.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OLL92_RS07365 (OLL92_07365) | - | 1501602..1502216 (+) | 615 | WP_264547798.1 | hypothetical protein | - |
| OLL92_RS07370 (OLL92_07370) | - | 1502914..1503144 (+) | 231 | Protein_1433 | hypothetical protein | - |
| OLL92_RS07375 (OLL92_07375) | - | 1503176..1503610 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| OLL92_RS07380 (OLL92_07380) | - | 1503591..1504874 (+) | 1284 | WP_002402493.1 | PBSX family phage terminase large subunit | - |
| OLL92_RS07385 (OLL92_07385) | - | 1504874..1506358 (+) | 1485 | WP_010822970.1 | phage portal protein | - |
| OLL92_RS07390 (OLL92_07390) | - | 1506351..1507277 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| OLL92_RS07395 (OLL92_07395) | - | 1507400..1508035 (+) | 636 | WP_010785401.1 | DUF4355 domain-containing protein | - |
| OLL92_RS07400 (OLL92_07400) | - | 1508049..1508945 (+) | 897 | WP_002363368.1 | hypothetical protein | - |
| OLL92_RS07405 (OLL92_07405) | - | 1509016..1509348 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| OLL92_RS07410 (OLL92_07410) | - | 1509345..1509620 (+) | 276 | WP_002364301.1 | hypothetical protein | - |
| OLL92_RS07415 (OLL92_07415) | - | 1509617..1509955 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OLL92_RS07420 (OLL92_07420) | - | 1509952..1510344 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| OLL92_RS07425 (OLL92_07425) | - | 1510363..1510968 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| OLL92_RS07430 (OLL92_07430) | - | 1510971..1511153 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| OLL92_RS07435 (OLL92_07435) | - | 1511202..1511774 (+) | 573 | WP_002402496.1 | immunoglobulin-like domain-containing protein | - |
| OLL92_RS07440 (OLL92_07440) | - | 1511828..1512226 (+) | 399 | WP_002402497.1 | tail assembly chaperone | - |
| OLL92_RS07445 (OLL92_07445) | - | 1512295..1512600 (+) | 306 | WP_002402498.1 | hypothetical protein | - |
| OLL92_RS07450 (OLL92_07450) | - | 1512587..1517041 (+) | 4455 | WP_002402500.1 | phage tail tape measure protein | - |
| OLL92_RS07455 (OLL92_07455) | - | 1517038..1517760 (+) | 723 | WP_002402501.1 | hypothetical protein | - |
| OLL92_RS07460 (OLL92_07460) | - | 1517760..1519205 (+) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| OLL92_RS07465 (OLL92_07465) | - | 1519211..1519951 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| OLL92_RS07470 (OLL92_07470) | - | 1519968..1520420 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| OLL92_RS07475 (OLL92_07475) | - | 1520439..1520834 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| OLL92_RS07480 (OLL92_07480) | - | 1520836..1520958 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| OLL92_RS07485 (OLL92_07485) | - | 1520969..1521349 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| OLL92_RS07490 (OLL92_07490) | - | 1521362..1522621 (+) | 1260 | WP_002401959.1 | LysM peptidoglycan-binding domain-containing protein | - |
| OLL92_RS07495 (OLL92_07495) | - | 1523475..1523675 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| OLL92_RS07500 (OLL92_07500) | - | 1523747..1524019 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| OLL92_RS07510 (OLL92_07510) | hemH | 1524735..1525676 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| OLL92_RS07515 (OLL92_07515) | - | 1526432..1526803 (+) | 372 | WP_099704299.1 | type II secretion system protein | - |
| OLL92_RS07520 (OLL92_07520) | comGF | 1526793..1527227 (+) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| OLL92_RS07525 (OLL92_07525) | comGG | 1527227..1527580 (+) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| OLL92_RS07530 (OLL92_07530) | - | 1527709..1528716 (+) | 1008 | WP_264547744.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=751894 OLL92_RS07255 WP_002356991.1 1489883..1490158(+) (comGC/cglC) [Enterococcus faecalis strain BE16]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=751894 OLL92_RS07255 WP_002356991.1 1489883..1490158(+) (comGC/cglC) [Enterococcus faecalis strain BE16]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |