Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | OLL90_RS08995 | Genome accession | NZ_CP110047 |
| Coordinates | 1821233..1821508 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain BE33 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1781966..1839613 | 1821233..1821508 | within | 0 |
Gene organization within MGE regions
Location: 1781966..1839613
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL90_RS08715 (OLL90_08715) | - | 1781966..1782973 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| OLL90_RS08720 (OLL90_08720) | comGG | 1783102..1783455 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| OLL90_RS08725 (OLL90_08725) | comGF | 1783455..1783889 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| OLL90_RS08730 (OLL90_08730) | - | 1783879..1784250 (-) | 372 | WP_002365830.1 | type II secretion system protein | - |
| OLL90_RS08735 (OLL90_08735) | - | 1784580..1784705 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| OLL90_RS08740 (OLL90_08740) | hemH | 1785001..1785943 (-) | 943 | Protein_1698 | ferrochelatase | - |
| OLL90_RS08750 (OLL90_08750) | - | 1786684..1786935 (-) | 252 | WP_002365832.1 | hypothetical protein | - |
| OLL90_RS08755 (OLL90_08755) | - | 1787007..1787207 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| OLL90_RS08760 (OLL90_08760) | - | 1788043..1789302 (-) | 1260 | WP_002365833.1 | LysM peptidoglycan-binding domain-containing protein | - |
| OLL90_RS08765 (OLL90_08765) | - | 1789315..1789695 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| OLL90_RS08770 (OLL90_08770) | - | 1789706..1789828 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| OLL90_RS08775 (OLL90_08775) | - | 1789830..1790225 (-) | 396 | WP_002399417.1 | hypothetical protein | - |
| OLL90_RS08780 (OLL90_08780) | - | 1790244..1790696 (-) | 453 | WP_002399418.1 | hypothetical protein | - |
| OLL90_RS08785 (OLL90_08785) | - | 1790713..1791453 (-) | 741 | WP_002399419.1 | hypothetical protein | - |
| OLL90_RS08790 (OLL90_08790) | - | 1791459..1792904 (-) | 1446 | WP_002399420.1 | phage tail spike protein | - |
| OLL90_RS08795 (OLL90_08795) | - | 1792904..1793626 (-) | 723 | WP_002399421.1 | hypothetical protein | - |
| OLL90_RS08800 (OLL90_08800) | - | 1793623..1798077 (-) | 4455 | WP_002399422.1 | phage tail tape measure protein | - |
| OLL90_RS08805 (OLL90_08805) | - | 1798064..1798369 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| OLL90_RS08810 (OLL90_08810) | - | 1798438..1798836 (-) | 399 | WP_002364304.1 | tail assembly chaperone | - |
| OLL90_RS08815 (OLL90_08815) | - | 1798899..1799207 (-) | 309 | WP_002364303.1 | hypothetical protein | - |
| OLL90_RS08820 (OLL90_08820) | - | 1799210..1799815 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| OLL90_RS08825 (OLL90_08825) | - | 1799834..1800226 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| OLL90_RS08830 (OLL90_08830) | - | 1800223..1800561 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OLL90_RS08835 (OLL90_08835) | - | 1800558..1800833 (-) | 276 | WP_002364301.1 | hypothetical protein | - |
| OLL90_RS08840 (OLL90_08840) | - | 1800830..1801162 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| OLL90_RS08845 (OLL90_08845) | - | 1801233..1802129 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| OLL90_RS08850 (OLL90_08850) | - | 1802142..1802777 (-) | 636 | WP_010730822.1 | DUF4355 domain-containing protein | - |
| OLL90_RS08855 (OLL90_08855) | - | 1802900..1803826 (-) | 927 | WP_002364298.1 | minor capsid protein | - |
| OLL90_RS08860 (OLL90_08860) | - | 1803819..1805303 (-) | 1485 | WP_002364297.1 | phage portal protein | - |
| OLL90_RS08865 (OLL90_08865) | - | 1805303..1806586 (-) | 1284 | WP_002364296.1 | PBSX family phage terminase large subunit | - |
| OLL90_RS08870 (OLL90_08870) | - | 1806567..1807001 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| OLL90_RS08875 (OLL90_08875) | - | 1807033..1807263 (-) | 231 | WP_002364294.1 | hypothetical protein | - |
| OLL90_RS08880 (OLL90_08880) | - | 1807799..1808413 (-) | 615 | WP_002384355.1 | hypothetical protein | - |
| OLL90_RS08890 (OLL90_08890) | - | 1808944..1809360 (-) | 417 | WP_002364339.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OLL90_RS08895 (OLL90_08895) | - | 1810268..1810696 (-) | 429 | WP_002364342.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OLL90_RS08900 (OLL90_08900) | - | 1810693..1811550 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| OLL90_RS08905 (OLL90_08905) | - | 1811550..1811750 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| OLL90_RS08910 (OLL90_08910) | - | 1811755..1812396 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| OLL90_RS08915 (OLL90_08915) | - | 1812401..1813135 (-) | 735 | WP_002364345.1 | ERF family protein | - |
| OLL90_RS08920 (OLL90_08920) | - | 1813128..1813445 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| OLL90_RS08925 (OLL90_08925) | - | 1813665..1814219 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| OLL90_RS08930 (OLL90_08930) | - | 1814504..1814842 (-) | 339 | WP_002364347.1 | hypothetical protein | - |
| OLL90_RS08935 (OLL90_08935) | - | 1814879..1815088 (-) | 210 | WP_002399426.1 | hypothetical protein | - |
| OLL90_RS08940 (OLL90_08940) | - | 1815143..1815331 (+) | 189 | WP_002364350.1 | YegP family protein | - |
| OLL90_RS08945 (OLL90_08945) | - | 1815357..1816082 (-) | 726 | WP_002364352.1 | phage regulatory protein | - |
| OLL90_RS08950 (OLL90_08950) | - | 1816121..1816432 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| OLL90_RS08955 (OLL90_08955) | - | 1816443..1816619 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| OLL90_RS08960 (OLL90_08960) | - | 1816931..1817263 (+) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| OLL90_RS08965 (OLL90_08965) | - | 1817280..1817624 (+) | 345 | WP_002364356.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OLL90_RS08970 (OLL90_08970) | - | 1817907..1818623 (+) | 717 | WP_258528752.1 | DUF4352 domain-containing protein | - |
| OLL90_RS08975 (OLL90_08975) | - | 1818683..1818757 (+) | 75 | Protein_1743 | ImmA/IrrE family metallo-endopeptidase | - |
| OLL90_RS08980 (OLL90_08980) | - | 1818791..1819520 (+) | 730 | Protein_1744 | ion transporter | - |
| OLL90_RS08985 (OLL90_08985) | - | 1819617..1820765 (+) | 1149 | WP_002364359.1 | site-specific integrase | - |
| OLL90_RS08990 (OLL90_08990) | comGD | 1820793..1821236 (-) | 444 | WP_002356992.1 | competence type IV pilus minor pilin ComGD | - |
| OLL90_RS08995 (OLL90_08995) | comGC/cglC | 1821233..1821508 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| OLL90_RS09000 (OLL90_09000) | comGB | 1821508..1822554 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| OLL90_RS09005 (OLL90_09005) | comGA | 1822511..1823479 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| OLL90_RS09010 (OLL90_09010) | - | 1823720..1825048 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| OLL90_RS09015 (OLL90_09015) | rlmN | 1825338..1826411 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| OLL90_RS09020 (OLL90_09020) | - | 1826536..1828365 (-) | 1830 | WP_002389252.1 | ABC transporter permease | - |
| OLL90_RS09025 (OLL90_09025) | - | 1828355..1829104 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| OLL90_RS09030 (OLL90_09030) | - | 1829222..1829923 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| OLL90_RS09035 (OLL90_09035) | - | 1830053..1832476 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| OLL90_RS09040 (OLL90_09040) | - | 1832790..1834001 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OLL90_RS09045 (OLL90_09045) | - | 1834030..1834935 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| OLL90_RS09050 (OLL90_09050) | - | 1835057..1836037 (+) | 981 | WP_002356979.1 | polyprenyl synthetase family protein | - |
| OLL90_RS09055 (OLL90_09055) | cydC | 1836117..1837883 (-) | 1767 | WP_002364368.1 | thiol reductant ABC exporter subunit CydC | - |
| OLL90_RS09060 (OLL90_09060) | cydD | 1837880..1839613 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=751750 OLL90_RS08995 WP_002356991.1 1821233..1821508(-) (comGC/cglC) [Enterococcus faecalis strain BE33]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=751750 OLL90_RS08995 WP_002356991.1 1821233..1821508(-) (comGC/cglC) [Enterococcus faecalis strain BE33]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |