Detailed information NTG0736917

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: OF864_RS14915
• Genome accession: NZ_CP106987
• Coordinates: 2908911..2909246 (+)
• Length: 111 a.a.
• NCBI ID: WP_000982014.1
• Uniprot ID: A0A9W5QVD6
• Organism: Bacillus cereus strain IBA1
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2896795..2909246	2908911..2909246	within	0

Gene organization within MGE regions

Location: 2896795..2909246

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OF864_RS14860 (OF864_14865)	-	2897429..2898784 (+)	1356	Protein_2859	DEAD/DEAH box helicase family protein	-
OF864_RS29455	-	2898767..2899095 (+)	329	Protein_2860	hypothetical protein	-
OF864_RS29460	-	2899145..2899357 (+)	213	WP_341473470.1	hypothetical protein	-
OF864_RS14865 (OF864_14870)	-	2899427..2899924 (+)	498	WP_070757444.1	phage holin family protein	-
OF864_RS14870 (OF864_14875)	-	2900004..2901066 (+)	1063	Protein_2863	N-acetylmuramoyl-L-alanine amidase	-
OF864_RS29465	-	2901131..2901346 (-)	216	WP_311315291.1	hypothetical protein	-
OF864_RS14875 (OF864_14880)	-	2901416..2902069 (-)	654	WP_000724008.1	hypothetical protein	-
OF864_RS14880 (OF864_14885)	-	2902424..2903524 (+)	1101	WP_000584829.1	aspartate phosphatase	-
OF864_RS14885 (OF864_14890)	-	2903521..2903736 (+)	216	WP_000756629.1	hypothetical protein	-
OF864_RS14890 (OF864_14895)	-	2904148..2904933 (-)	786	WP_283502212.1	hypothetical protein	-
OF864_RS14895 (OF864_14900)	-	2905043..2905690 (+)	648	WP_000165967.1	HD domain-containing protein	-
OF864_RS14900 (OF864_14905)	-	2905687..2907582 (+)	1896	WP_088361143.1	ABC-F family ATP-binding cassette domain-containing protein	-
OF864_RS14905 (OF864_14910)	-	2907658..2908389 (+)	732	WP_001260655.1	Bax inhibitor-1/YccA family protein	-
OF864_RS14910 (OF864_14915)	-	2908495..2908749 (+)	255	WP_000975131.1	DUF4318 domain-containing protein	-
OF864_RS14915 (OF864_14920)	ssbA	2908911..2909246 (+)	336	WP_000982014.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12741.59 Da
• Isoelectric Point: 9.4344

>NTDB_id=736917 OF864_RS14915 WP_000982014.1 2908911..2909246(+) (ssbA) [Bacillus cereus strain IBA1]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 336 bp

>NTDB_id=736917 OF864_RS14915 WP_000982014.1 2908911..2909246(+) (ssbA) [Bacillus cereus strain IBA1]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAGCTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.434	95.495	0.568
ssb	Latilactobacillus sakei subsp. sakei 23K	56.604	95.495	0.541
ssbB	Bacillus subtilis subsp. subtilis str. 168	51.786	100	0.523
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	94.595	0.432
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.636	99.099	0.432
ssbA	Streptococcus mutans UA159	40.909	99.099	0.405
ssbB/cilA	Streptococcus mitis NCTC 12261	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae TIGR4	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae D39	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae R6	40	99.099	0.396
ssbB/cilA	Streptococcus mitis SK321	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae Rx1	40	99.099	0.396