Detailed information NTG0736434

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P7F77_RS08170
• Genome accession: NZ_CP121204
• Coordinates: 1676867..1677178 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472255.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA0907
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1671867..1682178

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P7F77_RS08135 (P7F77_08140)	gcvPA	1672369..1673715 (-)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
P7F77_RS08140 (P7F77_08145)	gcvT	1673735..1674826 (-)	1092	WP_000093344.1	glycine cleavage system aminomethyltransferase GcvT	-
P7F77_RS08145 (P7F77_08150)	-	1674985..1675509 (-)	525	WP_001015120.1	shikimate kinase	-
P7F77_RS08150 (P7F77_08155)	-	1675499..1675645 (-)	147	WP_001789879.1	hypothetical protein	-
P7F77_RS08155 (P7F77_08160)	comGF	1675742..1676239 (-)	498	WP_001796472.1	competence type IV pilus minor pilin ComGF	Machinery gene
P7F77_RS08160 (P7F77_08165)	comGE	1676157..1676456 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
P7F77_RS08165 (P7F77_08170)	comGD	1676443..1676889 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
P7F77_RS08170 (P7F77_08175)	comGC	1676867..1677178 (-)	312	WP_000472255.1	competence type IV pilus major pilin ComGC	Machinery gene
P7F77_RS08175 (P7F77_08180)	-	1677192..1677710 (-)	519	Protein_1607	type II secretion system F family protein	-
P7F77_RS08180 (P7F77_08185)	-	1677813..1678985 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
P7F77_RS08185 (P7F77_08190)	-	1678999..1679592 (-)	594	Protein_1609	type II secretion system F family protein	-
P7F77_RS08190 (P7F77_08195)	comGA	1679564..1680538 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
P7F77_RS08195 (P7F77_08200)	-	1680590..1681213 (-)	624	WP_001223009.1	MBL fold metallo-hydrolase	-
P7F77_RS08200 (P7F77_08205)	-	1681210..1681539 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11301.33 Da
• Isoelectric Point: 8.5268

>NTDB_id=736434 P7F77_RS08170 WP_000472255.1 1676867..1677178(-) (comGC) [Staphylococcus aureus strain SA0907]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=736434 P7F77_RS08170 WP_000472255.1 1676867..1677178(-) (comGC) [Staphylococcus aureus strain SA0907]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369