Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | NYR15_RS00375 | Genome accession | NZ_CP103863 |
| Coordinates | 20774..21049 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain SJ82 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 15774..26049
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR15_RS00335 (NYR15_00335) | - | 15819..16151 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| NYR15_RS00340 (NYR15_00340) | - | 16329..16802 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| NYR15_RS00345 (NYR15_00345) | - | 16914..18101 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| NYR15_RS00350 (NYR15_00350) | - | 18126..19133 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| NYR15_RS00355 (NYR15_00355) | comGG | 19262..19615 (-) | 354 | WP_016618446.1 | competence type IV pilus minor pilin ComGG | - |
| NYR15_RS00360 (NYR15_00360) | comGF | 19615..20049 (-) | 435 | WP_010707381.1 | competence type IV pilus minor pilin ComGF | - |
| NYR15_RS00365 (NYR15_00365) | - | 20039..20365 (-) | 327 | WP_010775953.1 | type II secretion system protein | - |
| NYR15_RS00370 (NYR15_00370) | comGD | 20331..20777 (-) | 447 | WP_016618445.1 | competence type IV pilus minor pilin ComGD | - |
| NYR15_RS00375 (NYR15_00375) | comGC/cglC | 20774..21049 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| NYR15_RS00380 (NYR15_00380) | comGB | 21049..22095 (-) | 1047 | WP_016618444.1 | competence type IV pilus assembly protein ComGB | - |
| NYR15_RS00385 (NYR15_00385) | comGA | 22052..23020 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| NYR15_RS00390 (NYR15_00390) | - | 23261..24589 (-) | 1329 | WP_010816624.1 | APC family permease | - |
| NYR15_RS00395 (NYR15_00395) | rlmN | 24879..25952 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=726186 NYR15_RS00375 WP_002356991.1 20774..21049(-) (comGC/cglC) [Enterococcus faecalis strain SJ82]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=726186 NYR15_RS00375 WP_002356991.1 20774..21049(-) (comGC/cglC) [Enterococcus faecalis strain SJ82]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |