Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | NYR13_RS07120 | Genome accession | NZ_CP103860 |
| Coordinates | 1387653..1387964 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain R3-8 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1382653..1392964
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR13_RS07090 (NYR13_07090) | - | 1383436..1383639 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| NYR13_RS07095 (NYR13_07095) | - | 1383636..1384622 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| NYR13_RS07100 (NYR13_07100) | - | 1384622..1384951 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| NYR13_RS07105 (NYR13_07105) | - | 1384948..1385571 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| NYR13_RS07110 (NYR13_07110) | comGA | 1385623..1386597 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| NYR13_RS07115 (NYR13_07115) | comGB | 1386569..1387639 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| NYR13_RS07120 (NYR13_07120) | comGC | 1387653..1387964 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| NYR13_RS07125 (NYR13_07125) | comGD | 1387942..1388388 (+) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| NYR13_RS07130 (NYR13_07130) | comGE | 1388375..1388674 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| NYR13_RS07135 (NYR13_07135) | comGF | 1388592..1389089 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| NYR13_RS07140 (NYR13_07140) | - | 1389186..1389332 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| NYR13_RS07145 (NYR13_07145) | - | 1389322..1389846 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| NYR13_RS07150 (NYR13_07150) | gcvT | 1390005..1391096 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYR13_RS07155 (NYR13_07155) | gcvPA | 1391116..1392462 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=726167 NYR13_RS07120 WP_000472256.1 1387653..1387964(+) (comGC) [Staphylococcus aureus strain R3-8]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=726167 NYR13_RS07120 WP_000472256.1 1387653..1387964(+) (comGC) [Staphylococcus aureus strain R3-8]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |