NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	NF399_RS06135	Genome accession	NZ_CP103049
Coordinates	1239035..1239346 (+)	Length	103 a.a.
NCBI ID	WP_029625707.1	Uniprot ID	-
Organism	Staphylococcus capitis subsp. capitis strain DSM 20326
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1234035..1244346

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NF399_RS06105	-	1234808..1235011 (+)	204	WP_103175540.1	YqgQ family protein	-
NF399_RS06110	-	1235008..1235994 (+)	987	WP_002453336.1	ROK family glucokinase	-
NF399_RS06115	-	1235994..1236320 (+)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
NF399_RS06120	-	1236320..1236943 (+)	624	WP_002453335.1	MBL fold metallo-hydrolase	-
NF399_RS06125	comGA	1237001..1237975 (+)	975	WP_103175541.1	competence type IV pilus ATPase ComGA	Machinery gene
NF399_RS06130	comGB	1237947..1239016 (+)	1070	Protein_1163	competence type IV pilus assembly protein ComGB	-
NF399_RS06135	comGC	1239035..1239346 (+)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
NF399_RS06140	comGD	1239324..1239773 (+)	450	WP_121909863.1	competence type IV pilus minor pilin ComGD	-
NF399_RS06145	-	1239760..1240059 (+)	300	WP_002453332.1	hypothetical protein	-
NF399_RS06150	-	1239977..1240381 (+)	405	WP_229716900.1	ComGF family competence protein	-
NF399_RS06155	-	1240638..1241147 (+)	510	WP_029625706.1	shikimate kinase	-
NF399_RS06160	gcvT	1241356..1242447 (+)	1092	WP_016898186.1	glycine cleavage system aminomethyltransferase GcvT	-
NF399_RS06165	gcvPA	1242466..1243812 (+)	1347	WP_016898185.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11345.43 Da Isoelectric Point: 9.7122

                                >NTDB_id=721171 NF399_RS06135 WP_029625707.1 1239035..1239346(+) (comGC) [Staphylococcus capitis subsp. capitis strain DSM 20326]

MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI

KEGQKNCKSGQTISISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=721171 NF399_RS06135 WP_029625707.1 1239035..1239346(+) (comGC) [Staphylococcus capitis subsp. capitis strain DSM 20326]

ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATAATTAGTTTATTACT

TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA

ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA

AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369

Detailed information NTG0721171