Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | NQ052_RS08890 | Genome accession | NZ_CP102120 |
| Coordinates | 1783691..1783966 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain N775_PC7 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1740647..1802071 | 1783691..1783966 | within | 0 |
Gene organization within MGE regions
Location: 1740647..1802071
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ052_RS08590 (NQ052_08560) | - | 1740647..1741654 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| NQ052_RS08595 (NQ052_08565) | comGG | 1741783..1742136 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| NQ052_RS08600 (NQ052_08570) | comGF | 1742136..1742570 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| NQ052_RS08605 (NQ052_08575) | - | 1742560..1742886 (-) | 327 | WP_010775953.1 | type II secretion system protein | - |
| NQ052_RS08610 (NQ052_08580) | hemH | 1743688..1744629 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| NQ052_RS08620 (NQ052_08590) | - | 1745345..1745617 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| NQ052_RS08625 (NQ052_08595) | - | 1745689..1745889 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| NQ052_RS08630 (NQ052_08600) | - | 1746726..1747967 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| NQ052_RS08635 (NQ052_08605) | - | 1747968..1748201 (-) | 234 | WP_002384371.1 | phage holin | - |
| NQ052_RS08640 (NQ052_08610) | - | 1748194..1748415 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| NQ052_RS08645 (NQ052_08615) | - | 1748450..1748605 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| NQ052_RS08650 (NQ052_08620) | - | 1748607..1748927 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| NQ052_RS08655 (NQ052_08625) | - | 1748941..1749432 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| NQ052_RS08660 (NQ052_08630) | - | 1749432..1749719 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| NQ052_RS08665 (NQ052_08635) | - | 1749716..1750312 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| NQ052_RS08670 (NQ052_08640) | - | 1750305..1751186 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| NQ052_RS08675 (NQ052_08645) | - | 1751205..1754012 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| NQ052_RS08680 (NQ052_08650) | - | 1753994..1754728 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| NQ052_RS08685 (NQ052_08655) | - | 1754718..1757615 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| NQ052_RS08690 (NQ052_08660) | gpG | 1757863..1758213 (-) | 351 | WP_002370959.1 | phage tail assembly chaperone G | - |
| NQ052_RS08695 (NQ052_08665) | - | 1758266..1759114 (-) | 849 | WP_002384363.1 | major tail protein | - |
| NQ052_RS08700 (NQ052_08670) | - | 1759115..1759489 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| NQ052_RS08705 (NQ052_08675) | - | 1759492..1759890 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| NQ052_RS08710 (NQ052_08680) | - | 1759883..1760251 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| NQ052_RS08715 (NQ052_08685) | - | 1760248..1760592 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| NQ052_RS08720 (NQ052_08690) | - | 1760606..1760788 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| NQ052_RS08725 (NQ052_08695) | - | 1760817..1761704 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| NQ052_RS08730 (NQ052_08700) | - | 1761718..1762341 (-) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| NQ052_RS08735 (NQ052_08705) | - | 1762559..1762879 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| NQ052_RS08740 (NQ052_08710) | - | 1762944..1763165 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| NQ052_RS08745 (NQ052_08715) | - | 1763162..1764919 (-) | 1758 | WP_002384360.1 | head protein | - |
| NQ052_RS08750 (NQ052_08720) | - | 1764894..1766381 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| NQ052_RS08755 (NQ052_08725) | - | 1766393..1767682 (-) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| NQ052_RS08760 (NQ052_08730) | terS | 1767654..1768457 (-) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| NQ052_RS08765 (NQ052_08735) | - | 1768726..1769643 (+) | 918 | WP_002370955.1 | hypothetical protein | - |
| NQ052_RS08770 (NQ052_08740) | - | 1769681..1770259 (-) | 579 | WP_002370953.1 | sce7726 family protein | - |
| NQ052_RS08775 (NQ052_08745) | - | 1770403..1770636 (-) | 234 | WP_002389079.1 | hypothetical protein | - |
| NQ052_RS08785 (NQ052_08755) | - | 1771630..1772046 (-) | 417 | WP_010816133.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| NQ052_RS08790 (NQ052_08760) | - | 1772953..1773378 (-) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NQ052_RS08795 (NQ052_08765) | - | 1773396..1773695 (-) | 300 | WP_002389080.1 | MazG-like family protein | - |
| NQ052_RS08800 (NQ052_08770) | - | 1773696..1773998 (-) | 303 | WP_002389299.1 | hypothetical protein | - |
| NQ052_RS08805 (NQ052_08775) | - | 1774002..1775003 (-) | 1002 | WP_002389256.1 | Lin1244/Lin1753 domain-containing protein | - |
| NQ052_RS08810 (NQ052_08780) | - | 1775040..1775933 (-) | 894 | WP_002369907.1 | recombinase RecT | - |
| NQ052_RS08815 (NQ052_08785) | - | 1775933..1776877 (-) | 945 | WP_002389314.1 | YqaJ viral recombinase family protein | - |
| NQ052_RS08820 (NQ052_08790) | - | 1776975..1777202 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| NQ052_RS08825 (NQ052_08795) | - | 1777202..1777525 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| NQ052_RS08830 (NQ052_08800) | - | 1777569..1777754 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| NQ052_RS08835 (NQ052_08805) | - | 1777745..1777939 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| NQ052_RS08840 (NQ052_08810) | - | 1777992..1778174 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| NQ052_RS08845 (NQ052_08815) | - | 1778214..1778935 (-) | 722 | Protein_1710 | Rha family transcriptional regulator | - |
| NQ052_RS08850 (NQ052_08820) | - | 1778974..1779291 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| NQ052_RS08855 (NQ052_08825) | - | 1779297..1779488 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| NQ052_RS08860 (NQ052_08830) | - | 1779779..1780123 (+) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| NQ052_RS08865 (NQ052_08835) | - | 1780136..1780774 (+) | 639 | WP_002389292.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NQ052_RS08870 (NQ052_08840) | - | 1780892..1781656 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| NQ052_RS08875 (NQ052_08845) | - | 1781671..1782000 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| NQ052_RS08880 (NQ052_08850) | - | 1782075..1783223 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| NQ052_RS08885 (NQ052_08855) | comGD | 1783251..1783694 (-) | 444 | WP_025189135.1 | competence type IV pilus minor pilin ComGD | - |
| NQ052_RS08890 (NQ052_08860) | comGC/cglC | 1783691..1783966 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| NQ052_RS08895 (NQ052_08865) | comGB | 1783966..1785012 (-) | 1047 | WP_002401325.1 | competence type IV pilus assembly protein ComGB | - |
| NQ052_RS08900 (NQ052_08870) | comGA | 1784969..1785937 (-) | 969 | WP_002401324.1 | competence type IV pilus ATPase ComGA | - |
| NQ052_RS08905 (NQ052_08875) | - | 1786177..1787505 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| NQ052_RS08910 (NQ052_08880) | rlmN | 1787795..1788868 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| NQ052_RS08915 (NQ052_08885) | - | 1788993..1790822 (-) | 1830 | WP_002391458.1 | ABC transporter permease | - |
| NQ052_RS08920 (NQ052_08890) | - | 1790812..1791561 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| NQ052_RS08925 (NQ052_08895) | - | 1791679..1792380 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| NQ052_RS08930 (NQ052_08900) | - | 1792511..1794934 (-) | 2424 | WP_002411391.1 | DNA translocase FtsK | - |
| NQ052_RS08935 (NQ052_08905) | - | 1795248..1796459 (-) | 1212 | WP_002411392.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NQ052_RS08940 (NQ052_08910) | - | 1796488..1797393 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| NQ052_RS08945 (NQ052_08915) | - | 1797515..1798495 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| NQ052_RS08950 (NQ052_08920) | cydC | 1798575..1800341 (-) | 1767 | WP_002411395.1 | thiol reductant ABC exporter subunit CydC | - |
| NQ052_RS08955 (NQ052_08925) | cydD | 1800338..1802071 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=714499 NQ052_RS08890 WP_002356991.1 1783691..1783966(-) (comGC/cglC) [Enterococcus faecalis strain N775_PC7]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=714499 NQ052_RS08890 WP_002356991.1 1783691..1783966(-) (comGC/cglC) [Enterococcus faecalis strain N775_PC7]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |