NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	NF398_RS05880	Genome accession	NZ_CP102087
Coordinates	1213630..1213941 (-)	Length	103 a.a.
NCBI ID	WP_029625707.1	Uniprot ID	-
Organism	Staphylococcus capitis subsp. capitis strain K1-2-2-23
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1208630..1218941

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NF398_RS05845	gcvPA	1209167..1210513 (-)	1347	WP_023350206.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
NF398_RS05850	gcvT	1210532..1211623 (-)	1092	WP_023350205.1	glycine cleavage system aminomethyltransferase GcvT	-
NF398_RS05855	-	1211832..1212341 (-)	510	WP_029625706.1	shikimate kinase	-
NF398_RS05865	-	1212652..1212927 (-)	276	WP_260833079.1	hypothetical protein	-
NF398_RS05870	-	1212917..1213216 (-)	300	WP_023350203.1	hypothetical protein	-
NF398_RS05875	comGD	1213203..1213652 (-)	450	WP_023350202.1	competence type IV pilus minor pilin ComGD	-
NF398_RS05880	comGC	1213630..1213941 (-)	312	WP_029625707.1	competence type IV pilus major pilin ComGC	Machinery gene
NF398_RS05885	comGB	1213960..1215027 (-)	1068	WP_023350201.1	competence type IV pilus assembly protein ComGB	-
NF398_RS05890	comGA	1214999..1215973 (-)	975	WP_023350200.1	competence type IV pilus ATPase ComGA	Machinery gene
NF398_RS05895	-	1216031..1216654 (-)	624	WP_049399400.1	MBL fold metallo-hydrolase	-
NF398_RS05900	-	1216654..1216980 (-)	327	WP_002433945.1	MTH1187 family thiamine-binding protein	-
NF398_RS05905	-	1216980..1217966 (-)	987	WP_023350198.1	ROK family glucokinase	-
NF398_RS05910	-	1217963..1218166 (-)	204	WP_002433937.1	YqgQ family protein	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11345.43 Da Isoelectric Point: 9.7122

                                >NTDB_id=714219 NF398_RS05880 WP_029625707.1 1213630..1213941(-) (comGC) [Staphylococcus capitis subsp. capitis strain K1-2-2-23]

MLKKLKKSKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCDAQVKMVNSQIEAYTLKHNRNPNNIEELIAEGFI

KEGQKNCKSGQTISISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=714219 NF398_RS05880 WP_029625707.1 1213630..1213941(-) (comGC) [Staphylococcus capitis subsp. capitis strain K1-2-2-23]

ATATTAAAAAAACTAAAAAAATCTAAAGCTTTCACTTTAATTGAAATGTTACTTGTTTTATTAATTATTAGTTTATTACT

TATTTTAATTATACCTAATATTGCCAAACAAACAGCACATATCCAATCTACTGGTTGTGATGCTCAAGTAAAAATGGTAA

ATAGTCAAATTGAAGCATATACATTAAAGCATAATCGTAACCCTAATAATATTGAAGAATTAATTGCTGAAGGTTTTATA

AAAGAAGGACAGAAAAATTGTAAATCCGGACAAACTATTAGTATTTCAAATGGTGAGGCTGTTGCGAACTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	86.408	100	0.864
comGC	Staphylococcus aureus MW2	86.408	100	0.864
comYC	Streptococcus gordonii str. Challis substr. CH1	45.631	100	0.456
comGC/cglC	Streptococcus mitis SK321	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae TIGR4	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae D39	44.118	99.029	0.437
comGC/cglC	Streptococcus pneumoniae R6	44.118	99.029	0.437
comGC/cglC	Streptococcus mitis NCTC 12261	48.837	83.495	0.408
comYC	Streptococcus mutans UA159	46.591	85.437	0.398
comYC	Streptococcus mutans UA140	46.591	85.437	0.398
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	76.699	0.388
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369

Detailed information NTG0714219